Property Summary

NCBI Gene PubMed Count 107
Grant Count 109
R01 Count 96
Funding $16,726,445.6
PubMed Score 1153.35
PubTator Score 205.93

Knowledge Summary

Patent (6,975)

Expression

  Differential Expression (7)

Synonym

Accession P30542 A6NFY5 A6NGP4 A8K1L3 B3KXQ4 D2CGD0 Q6FHK3 Q8TAM8
Symbols RDC7

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

MLP Assay (22)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
More...

Gene RIF (77)

PMID Text
27333659 Its central activation could be and approach to achieving a shifted homeostasis in which physiology is downregulated to a homeostatically-regulated, stable hypometabolic state. (review)
26810542 A1R mRNA levels and A1R density in PBMCs from idiopathic normal-pressure hydrocephalus patients were significantly lower than control subjects
26317759 Results show that ADORA1 rs2228079 and ADORA2A rs5751876 polymorphisms are associated with the risk of Gilles de la Tourette Syndrome, co-morbid disorders, and may affect the age of tics onset in Polish population.
26213104 In postmortem human prefrontal cortex, adenosine A1 receptor is coupled preferentially, if not exclusively, to Galphai-3.
26154847 It has the intrinsic ability to form a heteromeric complex with metabotropic glutamate receptor type 1 and mutually modulate signaling.
25725289 Adenosine A1 receptor activation increases ENT1 activity via protein kinase C.
25661317 Paeoniflorin promotes the survival of cultured cortical neurons by increasing Akt and ERK1/2 phosphorylation via A1R-mediated transactivation of EGFR.
25429616 Stimulation of A1AR and A2BAR had a prominent anti-proliferative/pro-apoptotic effect on the glioblastoma stem cells.
25354767 Results document that endogenously formed adenosine can chaperone its cognate A1 receptor.
24943643 This study revealed variation of regional A1AR availability associated with ADORA1 and particularly ADORA2A SNPs, several of which had previously been shown to be associated with increased anxiety and panic disorder.
More...

AA Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILIN      1 - 70
IGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVTPRRAAVAIAGCWILSFVVGL     71 - 140
TPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYMVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQ    141 - 210
LNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGN    211 - 280
SAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPIDEDLPEERPDD                            281 - 326
//

Text Mined References (109)

PMID Year Title
27333659 2016 Hibernation, Hypothermia and a Possible Therapeutic "Shifted Homeostasis" Induced by Central Activation of A1 Adenosine Receptor (A1AR).
26810542 2016 Down-regulation of adenosine A1 and A2A receptors in peripheral cells from idiopathic normal-pressure hydrocephalus patients.
26317759 2015 Association of ADORA1 rs2228079 and ADORA2A rs5751876 Polymorphisms with Gilles de la Tourette Syndrome in the Polish Population.
26213104 2015 Adenosine A1( )receptors are selectively coupled to G?(i-3) in postmortem human brain cortex: Guanosine-5'-O-(3-[(35)S]thio)triphosphate ([(35)S]GTP?S) binding/immunoprecipitation study.
26154847 2015 Complex formation and functional interaction between adenosine A1 receptor and type-1 metabotropic glutamate receptor.
25725289 2015 Adenosine A1 receptor activation modulates human equilibrative nucleoside transporter 1 (hENT1) activity via PKC-mediated phosphorylation of serine-281.
25661317 2015 Paeoniflorin ameliorates ischemic neuronal damage in vitro via adenosine A1 receptor-mediated transactivation of epidermal growth factor receptor.
25429616 2014 Modulation of A1 and A2B adenosine receptor activity: a new strategy to sensitise glioblastoma stem cells to chemotherapy.
25354767 2015 Chaperoning of the A1-adenosine receptor by endogenous adenosine - an extension of the retaliatory metabolite concept.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
More...