Property Summary

Ligand Count 37
NCBI Gene PubMed Count 125
PubMed Score 2284.19
PubTator Score 966.18

Knowledge Summary

Patent

No data available

Protein-protein Interaction (2)

Gene RIF (108)

AA Sequence

MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE      1 - 70
LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY     71 - 140
LAWLAFTTTLNYCVWRDNHGWRGGRRLPE                                             141 - 169
//

Text Mined References (128)

PMID Year Title