Property Summary

NCBI Gene PubMed Count 111
PubMed Score 2078.35
PubTator Score 966.18

Knowledge Summary

Patent

No data available

Expression

Gene RIF (94)

PMID Text
27054921 This work implicates TSPO in the maintenance of mitochondrial membrane integrity and in the control of mitochondrial ROS production, ultimately favoring tissue regeneration.
26898800 We conclude that ScBsAbAgn-2/TSPO targeting of glioblastoma cell lines can be achieved in vitro and in vivo.
26835706 the effects of PK11195 on meningioma were associated the decrease of allopregnanolone biosynthesis, which was mediated by TSPO.
26608360 Study demonstrates that TSPO has an anti-inflammatory role in endothelial activation through the inhibition of VCAM1 and regulation of mitochondrial function in endothelial cells.
26551696 Studies confirmed that TSPO expression increases with tumor grade in astrocytomas but also that some overlap exists between Low-grade and anaplastic lesions.
26551695 The authors discuss findings about TSPO and its function in the steroidogenesis which are inconclusive at this time. [Review]
26551691 Study focuses on the current understanding of TSPO interplay with reactive oxygen species and the voltage-dependent anion channel to which it binds, in the regulation of cell mitophagy. [review]
26517124 Study show that TSPO is highly expressed in human glioma and correlates with grade and represents a promising target in human glioma imaging for detection and staging.
26472628 Elevations in microglial activity can be measured in vivo with positron emission tomography (PET) using radioligands specific for the 18kD translocator-protein (TSPO), which is expressed on microglia.
26182972 Our preliminary results suggest that TSPO brain imaging in GBM may be a useful tool for predicting tumor progression at follow-up and may be less susceptible to changes in blood-brain barrier permeability than (18)F-FET.
26123521 Data suggest that TSPO expression is tightly associated with metabolic state of adipocytes and differentiation of preadipocytes into white/brown adipocytes; TSPO expression may improve metabolic status of adipocytes and regulate glucose homeostasis.
25979194 differential expression in children with allergic asthma
25968977 Exposure of cells to CS resulted in alternation of biomolecules expressed by CLs peroxidation, reduction of TSPO binding, and depletion of the mitochondrial potential. This irreversible damage was enhanced in the presence of saliva
25635829 This study identifies key cholesterol binding enhancement motif in translocator protein 18 kDa.
25560467 Our findings highlight TSPO as a candidate for future investigations of antipsychotic-induced weight gain, and support the involvement of mitochondrial membrane components in this serious treatment side effect.
25453044 As demonstrated within a group of stroke and GBM patients, (123)I-CLINDE SPECT can be used for quantitative assessment of TSPO expression in vivo
25123025 TSPO is a biomarkers that can predict recovery from brain injury and myocarditis
25057196 Increased TSPO expression and microglial activation are not associated with cocaine abuse.
24998961 Data indicate that variation in the translocator protein (18 kDa) (TSPO) gene affects susceptibility to topic dermatitis (AD).
24814875 Data indicate that targeting 18 kDa translocator protein (TSPO) reduces macrophage lipid content and prevents macrophage foam cell formation.
24643083 XBD173 blockade provides a practical means of estimating VND for TSPO targeting radioligands.
24599476 TSPO is a promising molecular marker for imaging inflammatory cell activation in the retina.
24532136 it appears that 10(-5) M FGIN-1-27 reduces cell viability, cell metabolism, and mitochondrial function.
24403586 The mitochondrial TSPO protein inhibits HIV-1 envelope glycoprotein biosynthesis via the endoplasmic reticulum-associated protein. degradation pathway
24403586 Treatment with TSPO antagonists or knockdown of TSPO by shRNA activate HIV-1 replication in nonpermissive NKR cells by restoring HIV-1 gp120/gp41 biogenesis
24403586 Knockdown of TSPO by shRNA enhances HIV-1 replication in nonpermissive NKR cells
24402571 TSPO expression is able to distinguish differences in the severity of myocarditis between male subjects and female subjects.
24397957 These findings suggest that TSPO is highly expressed in reactive retinal microglia and a promising target to control microglial reactivity during retinal degeneration.
24168369 Results show that TSPO is involved in cell death induction by NH4Cl; TSPO ligands, depending on their concentration, bimodally modulated NH4Cl-induced toxicity
24050790 Data indicate that benzoxazolone derivative showed affinity binding with 18 kDa translocator protein (TSPO).
23967175 increases in TSPO levels at different stages of breast cancer progression results in the acquisition of distinct properties associated with malignancy
23942012 data indicate a nominal association between the rs6971 SNP in the TSPO gene and the diagnosis of BD.
23850810 PET imaging with [11C]PBR28 in subjects with mild-to-moderate depression and C-reactive protein levels <5 mg/L do not show that depressed subjects have neuroinflammation or microglial activation.
23785173 brain (11)C-PBR28 SUV is sensitive to TSPO genotype
23718075 These data are crucial for indentifying of regulatory processes for TSPO expression. Pathogenetic interconnection between MAPK signaling partway and TSPO is important for novel therapeutic approaches in melanoma treatment.
23281426 Voxel-based imaging of translocator protein 18 kDa (TSPO) in high-resolution PET.
23080515 role in melanoma growth and progression
22968319 TSPO genotype influences PBR28 binding in vitro and in vivo.
22956240 We suggest that TSPO protein expression is a potential peripheral biomarker of multiple sclerosis
22892349 Peripheral benzodiazepine receptor (PBR) binding, shown to reflect activated microglia, was greater in patients with mild cognitive impairment. MCI patients with PBR values higher than the control mean +0.5 S.D. developed dementia within 5 years.
22732722 These findings show that interactions between the TSPO and the glutamatergic system may play a role in tumor development of glioblastoma cells.
22645299 Implication of TSPO in the thyroid cancer cell response to oxidative stress suggested its potential role in the regulation of thyroid cancer cell response to treatment with radioiodine.
22629859 Apoptosis modulation by PMA occurs independently of TsPO expression in squamous cell carcinoma cells
22616995 PBR can inhibit endothelial activation through inhibition of mitochondrial ROS and/or VDAC-1 expression in endothelial cells
22547081 Intact TSPO appears to be able to counteract the invasive and angiogenic characteristics related to the aggressiveness of U118MG glioblastoma cells in vivo and in vitro.
22528235 Both IRF-4 and IBP might be involved in the pathogenesis of psoriasis vulgaris.
22472607 Testing for the rs6971 polymorphism may allow quantitative interpretation of TSPO PET studies with new generation of TSPO PET radioligands.
22348616 The genotype with the lowest TSPO expression levels in adult separation anxiety disorder (ASAD) was the normal pregnenolone production genotype, the Ala147Thr single nucleotide polymorphism confirmed an excess of the Thr147 allele in ASAD patients.
22238156 increased expression of TSPO in temporal lobe epilepsy
22127435 PK 11195 exerted a suppressive effect on VDAC1 and caused an increase in TSPO gene expression or protein levels.
22050847 This review describes the principles of positron emission tomography (PET) imaging, the rationale and challenges in targeting the TSPO as a means of quantifying microglial activation in vivo.
22008728 An 18-kDa Translocator Protein polymorphism explains differences in binding affinity of the PET radioligand PBR28.
21958735 these experiments constitute the first in-depth functional analysis of the human TSPO gene promoter and its transcriptional regulation
21498529 REVIEW article
21320609 The present data indicate that [(11)C]vinpocetine may serve as a molecular imaging biomarker of the activity of the TSPO system
20877624 Observational study of gene-disease association. (HuGE Navigator)
20872081 These results further define TSPO as an informative marker of glial activation in multiple sclerosis
20600583 This review focuses on the current knowledge regarding the chemicals, hormones, and molecular mechanisms regulating Tspo gene expression under physiological conditions in a tissue- and disease-specific manner.
20491643 Following exposure of saliva to cigarette smoke a three-fold decrease in the affinity of salivary TSPO to its specific ligand, [(3)H]PK 11195 (p < 0.01) occurred in the cellular fraction of the saliva.
20424634 reduction in [(11)C]PBR28 binding may not be interpreted simply as a reduction in TSPO density
20222126 Overexpression of translocator protein is associated with inflammatory bowel disease.
20085808 High TSPO protein levels are associated with oral cancer.
20056222 TSPO is expressed in macrophages in human carotid atherosclerosis
19846611 Results demonstrate that the Ala147Thr spontaneous amino acid substitution within TSPO is able to affect pregnenolone production, and should encourage further studies to investigate its potential role in polygenic dyslipidemias.
19789311 Blocking TSPO function in tumor cells induces cell death and denotes a survival role for TSPO in prostate cancer .
19692168 Observational study of gene-disease association. (HuGE Navigator)
19668118 Two allelic variants of TSPO gene, were tested for association with the presence of adult separation anxiety disorder.
19617321 Studies in patient populations will help determine whether (11)C-DPA-713 provides better sensitivity for evaluating increased TSPO expression.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19525468 (18)F-PBR06 is a longer-lived and promising alternative to (11)C-labeled radioligands to measure TSPOs as a biomarker of inflammation in the brain.
19525461 (11)C-AC-5216 is a promising PET ligand for quantifying PBR in the human brain.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19077109 results show variety of CNS cells capable of expressing TSPO; pattern of expression differs between normal & diseased CNS & among different diseases & cell types; microglia & macrophages remain chief cell type upregulating TSPO expression in brain disease
18806692 TSPO knockdown by genetic manipulation transforms the human HT29 cancer line to a more malignant type in-vitro.
18791274 TSPO may serve to open the mitochondrial permeability transition pore in response to anti-cancer drugs such as erucylphosphohomocholine
18670869 VDAC activation by the 18 kDa translocator protein (TSPO), implications for apoptosis.
18256758 Sharp inhibition of apoptosis and changes in the levels of cell proliferation in tumor cells were paralleled by decreased expression of peripheral benzodiazepine receptor in patients with squamous cell carcinoma & skin melanoma.
18158327 These findings reveal a previously unidentified pathway of the membrane integration of MOM proteins with multiple TMSs of the PBR.
18054208 TSPO expression evaluation is a useful biological marker of Adult Separation Anxiety Disorder
17561806 TSPO is located in mitochondrial membranes of HT-29 and reveal that its activation induces a rise in cytosolic Ca(2+), leading to the stimulation of Cl(-) secretion.
16919618 Our results showed an up-regulation of peripheral-type benzodiazepine receptor (PBR) in platelets of FM patients, and this seems to be related to the severity of fibromyalgic symptoms.
16868661 the intensity and extent of staining for PBR had a strong direct correlation with the grade of malignancy of the tumor, along with proliferative and apoptotic indices. The highest expression of PBR was in glioblastomas grade IV.
16511838 Observational study of gene-disease association. (HuGE Navigator)
16511838 Study provides new and important evidence that variation in the PBR gene influences susceptibility to panic disorder.
15769477 the subcellular localisation of PBR defines its function and that this receptor could be a possible target for new strategies against cancer
15648546 Our results represent first evidence of PBRs in parathyroid glands and suggest for them a role in influencing PTH release. A clear trend of PBR up-regulation in parathyroid adenoma was also found.
15473257 our results supported the hypothesis that PBR controls T-cell maturation and suggested mechanisms through which PBR may regulate thymocyte-positive selection.
15296476 involvement of PBRs in human pancreatic beta-cell function and survival.
15041726 High expression of PBR in this patient subgroup may be used to identify a new high risk population in breast cancer for which a more specific therapy would be beneficial.
14626449 These results indicate that elevated peripheral-type benzodiazepine receptor (PBR) expression is not common in aggressive tumors, but may be limited to certain cancers where elevated PBR expression is associated with tumor progression.
14584048 demonstrated that PBR is expressed in mesenchymal stem cells and that their ligands affect their proliferation and differentiation
12547158 This gene is amplified in MDA-MB-231 aggressive breast cancer cells
12374690 Overexpression of the peripheral benzodiazepine receptor is associated with colorectal cancer
11304832 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKE      1 - 70
LGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPY     71 - 140
LAWLAFTTTLNYCVWRDNHGWRGGRRLPE                                             141 - 169
//

Text Mined References (114)

PMID Year Title
27054921 2016 Translocator Protein-Mediated Stabilization of Mitochondrial Architecture during Inflammation Stress in Colonic Cells.
26898800 2016 A bispecific antibody (ScBsAbAgn-2/TSPO) target for Ang-2 and TSPO resulted in therapeutic effects against glioblastomas.
26835706 2016 The effects of PK11195 on meningioma was associated with allopregnanolone biosynthesis, which was mediated by translocator protein 18 KDa.
26608360 2015 The 18-kDa Translocator Protein Inhibits Vascular Cell Adhesion Molecule-1 Expression via Inhibition of Mitochondrial Reactive Oxygen Species.
26551696 2015 The 18-kDa mitochondrial translocator protein in gliomas: from the bench to bedside.
26551695 2015 Translocator protein: pharmacology and steroidogenesis.
26551691 2015 TSPO is a REDOX regulator of cell mitophagy.
26517124 2015 Preclinical TSPO Ligand PET to Visualize Human Glioma Xenotransplants: A Preliminary Study.
26472628 2016 Microglial Activity in People at Ultra High Risk of Psychosis and in Schizophrenia: An [(11)C]PBR28 PET Brain Imaging Study.
26182972 2015 TSPO Imaging in Glioblastoma Multiforme: A Direct Comparison Between 123I-CLINDE SPECT, 18F-FET PET, and Gadolinium-Enhanced MR Imaging.
26123521 2015 Translocator protein (18 kDa) as a pharmacological target in adipocytes to regulate glucose homeostasis.
25979194 Protein-protein interaction network analysis and identifying regulation microRNAs in asthmatic children.
25968977 2015 The Effect of Cigarette Smoke on the Translocator Protein (TSPO) in Cultured Lung Cancer Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25635829 2015 Identification of a key cholesterol binding enhancement motif in translocator protein 18 kDa.
25560467 2015 Investigation of TSPO variants in schizophrenia and antipsychotic treatment outcomes.
25453044 2014 In vivo quantification of cerebral translocator protein binding in humans using 6-chloro-2-(4'-123I-iodophenyl)-3-(N,N-diethyl)-imidazo[1,2-a]pyridine-3-acetamide SPECT.
25416956 2014 A proteome-scale map of the human interactome network.
25123025 2014 Biomarker and more: can translocator protein 18 kDa predict recovery from brain injury and myocarditis?
25057196 2014 Cocaine abuse in humans is not associated with increased microglial activation: an 18-kDa translocator protein positron emission tomography imaging study with [11C]PBR28.
24998961 2014 Stress sensitivity in patients with atopic dermatitis in relation to the translocator protein 18 kDa (TSPO).
24814875 2014 Targeting mitochondrial 18 kDa translocator protein (TSPO) regulates macrophage cholesterol efflux and lipid phenotype.
24643083 2014 Determination of [(11)C]PBR28 binding potential in vivo: a first human TSPO blocking study.
24599476 2014 Macroglia-microglia interactions via TSPO signaling regulates microglial activation in the mouse retina.
24532136 2014 In vitro effect of FGIN-1-27, a ligand to 18 kDa mitochondrial translocator protein, in human osteoblast-like cells.
24403586 2014 The mitochondrial translocator protein, TSPO, inhibits HIV-1 envelope glycoprotein biosynthesis via the endoplasmic reticulum-associated protein degradation pathway.
24402571 2014 Sex differences in translocator protein 18 kDa (TSPO) in the heart: implications for imaging myocardial inflammation.
24397957 2014 Translocator protein (18 kDa) (TSPO) is expressed in reactive retinal microglia and modulates microglial inflammation and phagocytosis.
24168369 2014 Concentration-dependent bimodal effect of specific 18 kDa translocator protein (TSPO) ligands on cell death processes induced by ammonium chloride: potential implications for neuropathological effects due to hyperammonemia.
24050790 2013 Identification of a novel benzoxazolone derivative as a selective, orally active 18 kDa translocator protein (TSPO) ligand.
23967175 2013 The 18-kDa translocator protein (TSPO) disrupts mammary epithelial morphogenesis and promotes breast cancer cell migration.
23942012 2013 Bipolar Disorder is associated with the rs6971 polymorphism in the gene encoding 18 kDa Translocator Protein (TSPO).
23850810 2013 The neuroinflammation marker translocator protein is not elevated in individuals with mild-to-moderate depression: a [¹¹C]PBR28 PET study.
23785173 2013 Influence of TSPO genotype on 11C-PBR28 standardized uptake values.
23718075 2013 [TSPO ligand PK11195 and MAPK inhibitor UO126 modulate tspo expression level].
23281426 2013 Voxel-based imaging of translocator protein 18 kDa (TSPO) in high-resolution PET.
23080515 2012 Role of translocator protein in melanoma growth and progression.
22968319 2013 A genetic polymorphism for translocator protein 18 kDa affects both in vitro and in vivo radioligand binding in human brain to this putative biomarker of neuroinflammation.
22956240 2013 Translocator protein 18 kDa (TSPO) expression in multiple sclerosis patients.
22892349 2012 Increased binding of peripheral benzodiazepine receptor in mild cognitive impairment-dementia converters measured by positron emission tomography with [¹¹C]DAA1106.
22732722 2012 Effects of 18-kDa translocator protein knockdown on gene expression of glutamate receptors, transporters, and metabolism, and on cell viability affected by glutamate.
22645299 2012 The expression of translocator protein in human thyroid cancer and its role in the response of thyroid cancer cells to oxidative stress.
22629859 [Apoptosis modulation by PMA occurs independently of TsPO expression in squamous cell carcinoma cells].
22616995 2012 Peripheral benzodiazepine receptor regulates vascular endothelial activations via suppression of the voltage-dependent anion channel-1.
22547081 2012 The 18 kDa translocator protein influences angiogenesis, as well as aggressiveness, adhesion, migration, and proliferation of glioblastoma cells.
22528235 2012 Expression of IRF-4 and IBP in skin lesions of patients with psoriasis vulgaris.
22472607 2012 Translocator protein (18?kDa) polymorphism (rs6971) explains in-vivo brain binding affinity of the PET radioligand [(18)F]-FEPPA.
22348616 2012 Role of translocator protein (18 kDa) in adult separation anxiety and attachment style in patients with depression.
22238156 2012 Increased in vivo expression of an inflammatory marker in temporal lobe epilepsy.
22127435 2011 In vitro mitochondrial effects of PK 11195, a synthetic translocator protein 18 kDa (TSPO) ligand, in human osteoblast-like cells.
22050847 2011 Imaging brain microglial activation using positron emission tomography and translocator protein-specific radioligands.
22008728 2012 An 18-kDa translocator protein (TSPO) polymorphism explains differences in binding affinity of the PET radioligand PBR28.
21958735 2012 Functional characterization of the human translocator protein (18kDa) gene promoter in human breast cancer cell lines.
21498529 2011 The translocator protein.
21320609 2011 Age and disease related changes in the translocator protein (TSPO) system in the human brain: positron emission tomography measurements with [11C]vinpocetine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20872081 2011 Translocator protein PET imaging for glial activation in multiple sclerosis.
20600583 2010 Regulation of translocator protein 18 kDa (TSPO) expression in health and disease states.
20491643 2010 Cigarette smoke decreases salivary 18 kDa translocator protein binding affinity--in association with oxidative stress.
20424634 2010 Two binding sites for [3H]PBR28 in human brain: implications for TSPO PET imaging of neuroinflammation.
20222126 2010 Overexpression of translocator protein in inflammatory bowel disease: potential diagnostic and treatment value.
20085808 2010 Oral cancer, cigarette smoke and mitochondrial 18kDa translocator protein (TSPO) - In vitro, in vivo, salivary analysis.
20056222 2010 Evaluation of translocator protein quantification as a tool for characterising macrophage burden in human carotid atherosclerosis.
19846611 2009 The spontaneous Ala147Thr amino acid substitution within the translocator protein influences pregnenolone production in lymphomonocytes of healthy individuals.
19789311 2009 Translocator protein blockade reduces prostate tumor growth.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19668118 2009 Ala147Thr substitution in translocator protein is associated with adult separation anxiety in patients with depression.
19617321 2009 Initial evaluation of 11C-DPA-713, a novel TSPO PET ligand, in humans.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19525468 2009 Quantification of translocator protein (18 kDa) in the human brain with PET and a novel radioligand, (18)F-PBR06.
19525461 2009 Quantitative analysis of peripheral benzodiazepine receptor in the human brain using PET with (11)C-AC-5216.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19077109 2009 Expression of the translocator protein of 18 kDa by microglia, macrophages and astrocytes based on immunohistochemical localization in abnormal human brain.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18806692 2008 The 18-kDa translocator protein, formerly known as the peripheral-type benzodiazepine receptor, confers proapoptotic and antineoplastic effects in a human colorectal cancer cell line.
18791274 2008 Ligands of the mitochondrial 18 kDa translocator protein attenuate apoptosis of human glioblastoma cells exposed to erucylphosphohomocholine.
18670869 2008 VDAC activation by the 18 kDa translocator protein (TSPO), implications for apoptosis.
18256758 2007 Expression of peripheral benzodiazepine receptor, PCNA, and caspase-3 in cells of skin melanoma and squamous cell carcinoma.
18158327 2007 A novel insertion pathway of mitochondrial outer membrane proteins with multiple transmembrane segments.
18054208 2008 Platelet 18 kDa Translocator Protein density is reduced in depressed patients with adult separation anxiety.
17561806 2007 Translocator protein (18 kDa) ligand PK 11195 induces transient mitochondrial Ca2+ release leading to transepithelial Cl- secretion in HT-29 human colon cancer cells.
17143515 2007 Cellular expression, localization and interactions of the product of the human MOST-1 gene associated with breast and prostate cancers.
16919618 2006 Peripheral benzodiazepine receptors on platelets of fibromyalgic patients.
16868661 2007 Immunohistochemical expression of peripheral benzodiazepine receptors in human astrocytomas and its correlation with grade of malignancy, proliferation, apoptosis and survival.
16822554 2006 Translocator protein (18kDa): new nomenclature for the peripheral-type benzodiazepine receptor based on its structure and molecular function.
16511838 2006 Evidence that variation in the peripheral benzodiazepine receptor (PBR) gene influences susceptibility to panic disorder.
16189298 2006 Peripheral benzodiazepine receptor: characterization in human T-lymphoma Jurkat cells.
15769477 2005 Nuclear location-dependent role of peripheral benzodiazepine receptor (PBR) in hepatic tumoral cell lines proliferation.
15648546 2004 Peripheral type benzodiazepine receptor in human parathyroid glands: up-regulation in adenoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15473257 2004 Expression of the peripheral benzodiazepine receptor triggers thymocyte differentiation.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15296476 2004 The role of peripheral benzodiazepine receptors on the function and survival of isolated human pancreatic islets.
15041726 2004 Immunohistochemical assessment of the peripheral benzodiazepine receptor in breast cancer and its relationship with survival.
14688214 2004 Immunohistochemical assessment of the peripheral benzodiazepine receptor in human tissues.
14630713 2004 Differential utilization of the promoter of peripheral-type benzodiazepine receptor by steroidogenic versus nonsteroidogenic cell lines and the role of Sp1 and Sp3 in the regulation of basal activity.
14626449 2003 Expression of peripheral benzodiazepine receptor (PBR) in human tumors: relationship to breast, colorectal, and prostate tumor progression.
14584048 2004 Effects of peripheral benzodiazepine receptor ligands on proliferation and differentiation of human mesenchymal stem cells.
12547158 2002 Peripheral-type benzodiazepine receptor (PBR) gene amplification in MDA-MB-231 aggressive breast cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374690 2002 Overexpression of the peripheral benzodiazepine receptor is a relevant prognostic factor in stage III colorectal cancer.
11304832 2001 No association of two missense variations of the benzodiazepine receptor (peripheral) gene and mood disorders in a Japanese sample.
11215759 2000 An association study between two missense variations of the benzodiazepine receptor (peripheral) gene and schizophrenia in a Japanese sample.
10591208 1999 The DNA sequence of human chromosome 22.
9915832 1999 Cloning and characterization of PRAX-1. A new protein that specifically interacts with the peripheral benzodiazepine receptor.
9027587 1997 Peripheral benzodiazepine receptors in isolated human pancreatic islets.
8307574 1993 The human peripheral benzodiazepine receptor gene: cloning and characterization of alternative splicing in normal tissues and in a patient with congenital lipoid adrenal hyperplasia.
8121239 1994 Characterization and differentiation of peripheral-type benzodiazepine receptors in rat and human prostate.
7721091 1995 Comparison of repetitive elements in the third intron of human and rodent mitochondrial benzodiazepine receptor-encoding genes.
3018615 1985 Comparison of benzodiazepine receptor binding in membranes from human or rat brain.
1847678 1991 Molecular cloning and chromosomal localization of a human peripheral-type benzodiazepine receptor.
1654492 1991 Peripheral-type benzodiazepine receptors in human cerebral cortex, kidney, and colon.
1326278 The human "peripheral-type" benzodiazepine receptor: regional mapping of the gene and characterization of the receptor expressed from cDNA.