Property Summary

NCBI Gene PubMed Count 195
Grant Count 101
R01 Count 34
Funding $23,300,073.74
PubMed Score 135.63
PubTator Score 147.56

Knowledge Summary

Patent (2,140)

Expression

  Differential Expression (13)

Disease log2 FC p
medulloblastoma 1.900 0.000
atypical teratoid / rhabdoid tumor 2.800 0.000
glioblastoma 1.700 0.000
medulloblastoma, large-cell 2.700 0.000
primitive neuroectodermal tumor 2.000 0.002
lung cancer 4.100 0.000
active Crohn's disease 1.392 0.029
lung adenocarcinoma 1.300 0.000
adult high grade glioma 1.100 0.010
non-small cell lung carcinoma 1.300 0.000
acute myeloid leukemia -1.900 0.007
Breast cancer 1.400 0.000
psoriasis 1.700 0.000

Synonym

Accession P30532 Q15824 Q99554
Symbols LNCR2

Gene

Gene RIF (193)

PMID Text
26942719 two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors
26909550 These results suggest that exposure to nicotine might negatively impact the apoptotic potential of chemotherapeutic drugs and that alpha5-nAChR/AKT signaling plays a key role in the anti-apoptotic activity of nicotine induced by cisplatin.
26757861 No associations were found between the analyzed variants and smoking, however, there was an association among non-smoking subjects between the A allele of rs16969968 and high body mass index.
26689306 suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers
26434895 Our meta-analysis provided statistical evidence for a strong association between rs16969968 polymorphism and the risk of lung cancer, especially in smokers and Caucasians.
26228411 This study showed that CHRNA5(rs16969968) interacted with chronic low family support in association with child mental health status
26220977 A novel regulatory SNP association with nicotine dependence was found. Previously observed differences in CHRNA5 mRNA expression and nicotine dependence risk were connected to underlying DNA methylation differences.
26184988 In non-Hispanic White participants, a novel association between rs1289899 in the CHRNA5 gene and posttraumatic stress disorder was observed.
26010901 Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers.
25941207 Preventive interventions in adolescents reduced the genetic risk for smoking from rs16969968 CHRNA5.
More...

AA Sequence

MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLND      1 - 70
KIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNAD     71 - 140
GRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKR    141 - 210
DFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGE    211 - 280
KICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAP    281 - 350
LVRKIFLHTLPKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW    351 - 420
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK                          421 - 468
//

Text Mined References (196)

PMID Year Title
26942719 2016 Chromosome 15q25 (CHRNA3-CHRNB4) Variation Indirectly Impacts Lung Cancer Risk in Chinese Males.
26909550 2016 Nicotine Inhibits Cisplatin-Induced Apoptosis via Regulating ?5-nAChR/AKT Signaling in Human Gastric Cancer Cells.
26757861 2015 [Association between genotype and allele frequencies of CYP2A6*12 and rs16969968 in CHRNA5 variants with smoking and body mass index in young subjects from Northeast Mexico].
26689306 2016 Gene variance in the nicotinic receptor cluster (CHRNA5-CHRNA3-CHRNB4) predicts death from cardiopulmonary disease and cancer in smokers.
26434895 2015 CHRNA5 rs16969968 Polymorphism Association with Risk of Lung Cancer--Evidence from 17,962 Lung Cancer Cases and 77,216 Control Subjects.
26228411 2015 Examining gene-environment interactions in comorbid depressive and disruptive behavior disorders using a Bayesian approach.
26220977 2015 A multiancestry study identifies novel genetic associations with CHRNA5 methylation in human brain and risk of nicotine dependence.
26184988 2015 Effect of genetic variation in the nicotinic receptor genes on risk for posttraumatic stress disorder.
26010901 2015 Lack of Associations of CHRNA5-A3-B4 Genetic Variants with Smoking Cessation Treatment Outcomes in Caucasian Smokers despite Associations with Baseline Smoking.
25941207 2016 An Adolescent Substance Prevention Model Blocks the Effect of CHRNA5 Genotype on Smoking During High School.
More...