Property Summary

NCBI Gene PubMed Count 212
PubMed Score 143.07
PubTator Score 147.56

Knowledge Summary

Patent (2,140)

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer 2.400 8.5e-04
active Crohn's disease 1.392 2.9e-02
acute myeloid leukemia -1.900 7.1e-03
adult high grade glioma 1.100 1.0e-02
atypical teratoid / rhabdoid tumor 2.800 1.2e-08
Breast cancer 1.400 1.8e-05
glioblastoma 1.700 2.7e-04
lung adenocarcinoma 1.300 1.7e-04
medulloblastoma 1.300 8.4e-04
medulloblastoma, large-cell 2.700 4.7e-06
non-small cell lung carcinoma 1.300 2.1e-11
primitive neuroectodermal tumor 2.000 2.1e-03
psoriasis 1.700 2.3e-62

Protein-protein Interaction (1)

Gene RIF (209)

AA Sequence

MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLND      1 - 70
KIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNAD     71 - 140
GRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKR    141 - 210
DFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGE    211 - 280
KICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAP    281 - 350
LVRKIFLHTLPKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW    351 - 420
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK                          421 - 468
//

Text Mined References (213)

PMID Year Title