Property Summary

NCBI Gene PubMed Count 174
Grant Count 128
R01 Count 73
Funding $11,777,624.1
PubMed Score 450.93
PubTator Score 521.37

Knowledge Summary

Patent (74,117)

Expression

  Differential Expression (25)

Synonym

Accession P30530 Q8N5L2 Q9UD27
Symbols ARK
UFO
JTK11
Tyro7

Gene

AXL

PDB

2C5D   4RA0  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (150)

PMID Text
26815723 Incubation with sunitinib of renal cell carcinoma cells causes significant upregulation of multiple phosphopeptides including Axl.
26760782 High HIF-1alpha expression is significantly associated with Axl and VEGF expression, and with markers of poor prognosis in this series of breast cancer.
26759246 Vimentin and Axl mRNA and protein were expressed in a subset of human TNBC tumors.
26667302 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells by activating the transcription factor ELK1 via the JNK signaling pathway.
26475093 study emphasized that the AXL and EGFR receptor tyrosine kinases were coexpressed in a subgroup of treatment-naive lung adenocarcinomas with or without EGFR mutations
26356564 Identified an Axl-associated signature of 62 genes able to portray the high-grade ovarian cancer patients with the shortest overall survival.
26350366 High expression of Axl correlated with Upper Tract Urothelial Carcinoma.
26313459 patients possessing the favourable IFNL3 rs12979860 genotype associated with treatment response, showed lower AXL expression in the liver and a stronger induction of AXL in the blood, following their first dose of IFN.
26206560 Gas6-induced Axl signaling is a critical driver of pancreatic cancer progression.
26180925 The Axl antibody hMAb173 significantly induced RCC cell apoptosis.
More...

AA Sequence

MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWL      1 - 70
RDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPY     71 - 140
FLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSCEAHNA    141 - 210
KGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLSNDGMGIQAGEPDPPE    211 - 280
EPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAF    281 - 350
VHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP    351 - 420
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETRYGEVFEPTVE    421 - 490
RGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDS    491 - 560
ILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRLIGVCFQGSERESFPAPVVILPFMKHGDLHS    561 - 630
FLLYSRLGDQPVYLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG    631 - 700
DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQ    701 - 770
PADCLDGLYALMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA    771 - 840
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA                    841 - 894
//

Text Mined References (184)

PMID Year Title
26815723 2016 Sunitinib activates Axl signaling in renal cell cancer.
26760782 2016 Strong Expression of Hypoxia-Inducible Factor-1? (HIF-1?) Is Associated with Axl Expression and Features of Aggressive Tumors in African Breast Cancer.
26759246 2016 The TRAIL receptor agonist drozitumab targets basal B triple-negative breast cancer cells that express vimentin and Axl.
26667302 2016 Negative feedback regulation of AXL by miR-34a modulates apoptosis in lung cancer cells.
26475093 2015 Coexpression of receptor tyrosine kinase AXL and EGFR in human primary lung adenocarcinomas.
26356564 2015 Novel Axl-driven signaling pathway and molecular signature characterize high-grade ovarian cancer patients with poor clinical outcome.
26350366 2016 Relationship Between Increased Expression of the Axl/Gas6 Signal Cascade and Prognosis of Patients with Upper Tract Urothelial Carcinoma.
26313459 2015 Hepatitis C Virus Driven AXL Expression Suppresses the Hepatic Type I Interferon Response.
26206560 2015 Warfarin Blocks Gas6-Mediated Axl Activation Required for Pancreatic Cancer Epithelial Plasticity and Metastasis.
26180925 2015 Axl receptor tyrosine kinase is a potential therapeutic target in renal cell carcinoma.
More...