Property Summary

NCBI Gene PubMed Count 17
Grant Count 6
R01 Count 5
Funding $1,439,493.17
PubMed Score 91.03
PubTator Score 30.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession P30520 B1AQM5 Q96EG7 AMPSase 2
Symbols ADEH
ADSS 2

Gene

PANTHER Protein Class (1)

PDB

2V40  

Gene RIF (4)

PMID Text
19115993 These findings suggest that the combined effects of the polymorphisms in the ADSS and ATM genes may confer susceptibility to the development of schizophrenia in a Chinese population
19115993 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18721483 Observational study of gene-disease association. (HuGE Navigator)
18469177 Kinetic data reveal that human Ser(289) and B. subtilis Ser(262) and Ser(263) are essential for catalysis, while the ability of these Ser mutants to bind APBADP suggests that they do not contribute to substrate affinity

AA Sequence

MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTV      1 - 70
VVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFH     71 - 140
QAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLE    141 - 210
IDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVC    211 - 280
TGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAH    281 - 350
MINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE    351 - 420
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF                                      421 - 456
//

Text Mined References (20)

PMID Year Title
25134534 2014 Genome-wide association study identifies new susceptibility loci for epithelial ovarian cancer in Han Chinese women.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
19115993 2008 Association analyses of the interaction between the ADSS and ATM genes with schizophrenia in a Chinese population.
18721483 2008 An association study of ADSS gene polymorphisms with schizophrenia.
18469177 2008 Effect of a new non-cleavable substrate analog on wild-type and serine mutants in the signature sequence of adenylosuccinate lyase of Bacillus subtilis and Homo sapiens.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...