Property Summary

Ligand Count 2
NCBI Gene PubMed Count 17
PubMed Score 94.96
PubTator Score 30.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.500 2.2e-02
ductal carcinoma in situ 1.300 1.7e-04
intraductal papillary-mucinous adenoma (... 1.200 4.2e-02
intraductal papillary-mucinous neoplasm ... 1.700 2.4e-02
invasive ductal carcinoma 1.300 3.3e-03
lung adenocarcinoma 1.189 1.0e-06
lung cancer 1.300 1.3e-04
oligodendroglioma -1.200 4.0e-02
ovarian cancer 1.500 1.9e-03
Pick disease -1.300 4.0e-03

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTV      1 - 70
VVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFH     71 - 140
QAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLE    141 - 210
IDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVC    211 - 280
TGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAH    281 - 350
MINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKE    351 - 420
LPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF                                      421 - 456
//

Text Mined References (20)

PMID Year Title