Property Summary

NCBI Gene PubMed Count 59
Grant Count 242
R01 Count 158
Funding $28,962,771.47
PubMed Score 954.02
PubTator Score 476.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
psoriasis 1.900 0.000
medulloblastoma -1.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.548 0.010
adult high grade glioma -1.200 0.000
subependymal giant cell astrocytoma -1.413 0.029
gastric carcinoma -1.100 0.012

Synonym

Accession P30519 A8MT35 D3DUD5 I3L430 O60605 HO-2
Symbols HO-2

Gene

PANTHER Protein Class (2)

PDB

2Q32   2QPP   2RGZ   4WMH  

 IMPC Term (1)

Gene RIF (42)

PMID Text
26781569 HMOX2 contributes to high-altitude adaptation in Tibetans by functioning as a modifier in the regulation of hemoglobin metabolism.
26652036 The same mechanism of heme hydroxylation to alpha-meso-hydroxyheme is employed by both isoforms HO-1 and HO-2.
26091465 a weak association between HMOX2 rs1051308 polymorphisms and the risk to develop essential tremor in the Spanish population.
25864768 HO-2 protein is expressed in the cytosols of skin cancer cells.
25849895 Taken together with EPR measurements, which show the appearance of a new low-spin heme signal in reduced HO2, it appears that a cysteine residue(s) in the HRMs directly interacts with a second bound heme
25196843 Interactions of HO-2 with CPR and BVR, were evaluated.
23792437 We believe that a dysfunctional HO-ferritin system leads to increased levels of proinflammatory mediators, thus contributing to the inflammation characteristic of pterygia.
22935040 increased expression of nucleated RBC, HSP90alpha and corresponding decreased expression of HO-2 in such hypoxic condition may play a protective role; to prevent cord blood RBC against stress induced damage during preeclampsia.
22923613 Role of cysteine residues in heme binding to human heme oxygenase-2 elucidated by two-dimensional NMR spectroscopy.
22892400 PFKFB4 and HO-2 are expressed in a coordinated manner to maintain glucose homeostasis.
More...

AA Sequence

MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA      1 - 70
TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY     71 - 140
IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD    141 - 210
LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS    211 - 280
SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM                                      281 - 316
//

Text Mined References (65)

PMID Year Title
26781569 2016 HMOX2 Functions as a Modifier Gene for High-Altitude Adaptation in Tibetans.
26652036 2016 Comparison of the Mechanisms of Heme Hydroxylation by Heme Oxygenases-1 and -2: Kinetic and Cryoreduction Studies.
26091465 2015 Heme Oxygenase 1 and 2 Common Genetic Variants and Risk for Essential Tremor.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25864768 The heme oxygenase/biliverdin reductase system in skin cancers.
25849895 2015 Spectroscopic studies reveal that the heme regulatory motifs of heme oxygenase-2 are dynamically disordered and exhibit redox-dependent interaction with heme.
25196843 2014 Protein/protein interactions in the mammalian heme degradation pathway: heme oxygenase-2, cytochrome P450 reductase, and biliverdin reductase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23792437 2013 Dysregulated heme oxygenase-ferritin system in pterygium pathogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...