Property Summary

NCBI Gene PubMed Count 64
PubMed Score 967.86
PubTator Score 476.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.200 3.2e-05
gastric carcinoma -1.100 1.2e-02
group 3 medulloblastoma -1.100 3.7e-05
malignant mesothelioma -1.100 7.7e-06
pancreatic ductal adenocarcinoma liver m... -1.548 1.0e-02
psoriasis 1.100 1.1e-07
subependymal giant cell astrocytoma -1.413 2.9e-02

Protein-protein Interaction (11)

Gene RIF (47)

AA Sequence

MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA      1 - 70
TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY     71 - 140
IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD    141 - 210
LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS    211 - 280
SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM                                      281 - 316
//

Text Mined References (70)

PMID Year Title