Property Summary

NCBI Gene PubMed Count 126
Grant Count 730
R01 Count 149
Funding $1,022,753,194.35
PubMed Score 1792.98
PubTator Score 427.33

Knowledge Summary

Patent (5,813)

Expression

Synonym

Accession P30518 C5HF20 O43192 Q3MJD3 Q9UCV9 V2R
Symbols DI1
DIR
NDI
V2R
ADHR
DIR3

Gene

PANTHER Protein Class (2)

PDB

4JQI  

  TechDev Info (1)

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
463201 other 0 / 0 / 30 SAR Analysis using an Image-based Vasopressin Agonist Counter Assay for the Identification of Selective Antagonists of the GPR35 Receptor
463202 other 0 / 0 / 30 SAR Analysis using an Image-based Vasopressin Antagonist Counter Assay for the Identification of Selective Antagonists of the GPR35 Receptor
743058 confirmatory 9 / 0 / 22 Late-stage results from the probe development effort to identify antagonists of arginine vasopressin receptor 1a (AVPR1a): fluorescence-based cell-based dose response AVPR2 inhibition counterscreen assay

Gene RIF (80)

PMID Text
27117808 We present a novel mutation in codon 137 within AVPR2 with substitution of glycine for arginine in male dizygotic twins.
26244674 A heterozygous deletion in exon 1 of the AVPR2 gene is associated with nephrogenic diabetes insipidus.
26131744 In this study, we identified and characterized a new gain-of function mutation of the V2R, which leads to nephrogenic syndrome of inappropriate diuresis.
24944242 AVP acting at V2R does not appear to regulate water losses from body fluids other than renal excretion during exercise.
24628417 Rescue of the N321K-V2R function by Val(4)-desmopressin action in nephrogenic diabetes insipidus.
24556353 This review summarizes some of the unexpected roles of V2R signaling and suggests that vasopressin signaling itself may contribute crucially to loss of polarity and enhanced proliferation in cystic kidney epithelium.
24026507 X-linked nephrogenic diabetes insipidus and severity of illness in this family is caused by a novel deletion in the AVPR2 gene
23935101 vasopressin receptor type 2 signaling is controlled by retromer and arrestin in a noncanonical regulatory pathway
23762448 Three vasopressin receptor 2 variants: an apparent polymorphism (V266A) and two loss-of-function mutations (R181C and M311V) may be related to nephrogenic syndrome of inappropriate antidiuresis and to nephrogenic diabetes insipidus.
23604254 crystal structure of beta-arrestin-1 (also called arrestin-2) in complex with a fully phosphorylated 29-amino-acid carboxy-terminal peptide derived from the human V2 vasopressin receptor (V2Rpp)
More...

AA Sequence

MLMASTTSAVPGHPSLPSLPSNSSQERPLDTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGH      1 - 70
WAPIHVFIGHLCLADLAVALFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRA     71 - 140
ICRPMLAYRHGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWIA    141 - 210
LMVFVAPTLGIAACQVLIFREIHASLVPGPSERPGGRRRGRRTGSPGEGAHVSAAVAKTVRMTLVIVVVY    211 - 280
VLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPS    281 - 350
LGPQDESCTTASSSLAKDTSS                                                     351 - 371
//

Text Mined References (129)

PMID Year Title
27117808 2016 A novel mutation affecting the arginine-137 residue of AVPR2 in dizygous twins leads to nephrogenic diabetes insipidus and attenuated urine exosome aquaporin-2.
26244674 2016 An unusual case of hereditary nephrogenic diabetes insipidus (HNDI) affecting mother and daughter.
26131744 2015 Mutation in the V2 vasopressin receptor gene, AVPR2, causes nephrogenic syndrome of inappropriate diuresis.
24944242 2014 Characterization of the effects of the vasopressin V2 receptor on sweating, fluid balance, and performance during exercise.
24628417 2014 Altered agonist sensitivity of a mutant v2 receptor suggests a novel therapeutic strategy for nephrogenic diabetes insipidus.
24556353 2014 Vasopressin-2 receptor signaling and autosomal dominant polycystic kidney disease: from bench to bedside and back again.
24026507 2014 A large deletion of the AVPR2 gene causing severe nephrogenic diabetes insipidus in a Turkish family.
23935101 2013 Noncanonical control of vasopressin receptor type 2 signaling by retromer and arrestin.
23762448 2013 Characterization of three vasopressin receptor 2 variants: an apparent polymorphism (V266A) and two loss-of-function mutations (R181C and M311V).
23604254 2013 Structure of active ?-arrestin-1 bound to a G-protein-coupled receptor phosphopeptide.
More...