Property Summary

NCBI Gene PubMed Count 54
Grant Count 7
R01 Count 5
Funding $1,116,470.37
PubMed Score 67.36
PubTator Score 55.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (110)

PMID Text
26928464 Overexpression of a single MHCI molecule, HLA-F, protects human MNs from ALS astrocyte-mediated toxicity, whereas knockdown of its receptor, the killer cell immunoglobulin-like receptor KIR3DL2, on human astrocytes results in enhanced motor neurons death
26332651 provides substantial evidence that the rs7903146 variant is significantly associated with the risk of diabetic retinopathy in Caucasian populations
25862890 We identified that the HLA-E and HLA-F in gastric cancer independently affected clinical factors, including postoperative outcome
25461528 The effect of Japanese encephalitis virus and TNF-alpha exposure on NFkappaB-mediated induction of HLA-F is reported.
25420801 Review of the impact of human leukocyte antigen molecules E, F, and G on the outcome of transplantation.
25413105 This is the first study regarding HLA-F polymorphisms in a Euro-Brazilian population contributing to the Southern Brazilian genetic characterization.
24018270 HLA-F and MHC class I open conformers are ligands for NK cell Ig-like receptors.
23851683 A previously unrecognized model of Ag cross-presentation mediated by HLA-F & MHC-I open conformers on activated lymphocytes & monocytes may significantly contribute to the regulation of immune system functions & the immune defense.
23542057 expression in gastric cancer lesion was unrelated to patient prognosis
22980333 HIV-1 Nef downregulates the expression of MHC-I at the surface of lymphoid, monocytic and epithelial cells, causing MHC-I molecules to be rapidly internalized, accumulated in endosomal vesicles and degraded
More...

AA Sequence

MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPRE      1 - 70
PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYD     71 - 140
GKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRADPPKAHV    141 - 210
AHHPISDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTC    211 - 280
HVQHEGLPQPLILRWEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV        281 - 346
//

Text Mined References (55)

PMID Year Title
26928464 2016 Major histocompatibility complex class I molecules protect motor neurons from astrocyte-induced toxicity in amyotrophic lateral sclerosis.
26332651 2015 Clinical implication of human leukocyte antigen (HLA)-F expression in breast cancer.
25862890 2015 Human leukocyte antigen (HLA)-E and HLA-F expression in gastric cancer.
25461528 2014 Infection of human amniotic and endothelial cells by Japanese encephalitis virus: Increased expression of HLA-F.
25420801 2014 Impact of human leukocyte antigen molecules E, F, and G on the outcome of transplantation.
25413105 2014 HLA-F polymorphisms in a Euro-Brazilian population from Southern Brazil.
24018270 2013 HLA-F and MHC class I open conformers are ligands for NK cell Ig-like receptors.
23851683 2013 HLA-F and MHC-I open conformers cooperate in a MHC-I antigen cross-presentation pathway.
23542057 2013 Lesion HLA-F expression is irrelevant to prognosis for patients with gastric cancer.
22544725 2013 Alteration of HLA-F and HLA I antigen expression in the tumor is associated with survival in patients with esophageal squamous cell carcinoma.
More...