Property Summary

NCBI Gene PubMed Count 784
PubMed Score 830.51
PubTator Score 146.73

Knowledge Summary

Patent

No data available

 GO Function (1)

 CSPA Cell Line (2)

Gene RIF (814)

AA Sequence

MRVMAPRTLILLLSGALALTETWACSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE      1 - 70
PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMFGCDLGPDGRLLRGYDQS     71 - 140
AYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPK    141 - 210
THVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAAS    281 - 350
SNSAQGSDESLIACKA                                                          351 - 366
//

Text Mined References (786)

PMID Year Title