Property Summary

NCBI Gene PubMed Count 755
PubMed Score 777.37
PubTator Score 146.73

Knowledge Summary

Patent

No data available

 GO Function (1)

 CSPA Cell Line (2)

Gene RIF (783)

PMID Text
26828202 HLA-C expressed on HIV-infected cells restricts attack by KIR2DL(+) CD56(dim) natural killer (NK) cells
26613595 four amino-acid positions of HLA-B and -C account for most of the associations between ankylosing spondylitis and MHC in the Korean population
26600554 Therefore, the results obtained in this study demonstrate the involvement of HLA class I genes in the susceptibility or resistance to American cutaneous leishmaniasis (ACL), with significant association between HLA-C*04 and ACL susceptibility.
26589762 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency
26542067 gene polymorphism is associated with Crohn's disease in Spanish patients
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26470763 HLA-C genetic polymorphism is associated with psoriasis.
26416275 Data suggest regulatory interactions between major histocompatibility antigen HLA-C and killer cell Ig-like receptor (KIR) might promote Graft-versus-Leukemia effects following transplantation.
26383988 HLA-C2 and -C1, showed highly significant associations with CRC development.
26372271 The authors have identified a deleterious effect of the KIR2DL3-HLA-C1 receptor-ligand combination on HIV clinical outcomes in a Thai cohort.
26262501 Preformed anti-HLA-Cw and anti-HLA-DP donor specific antibodies have deleterious impact in kidney transplantation.
26206121 genetic polymorphism is associated with the course of Hepatitis C virus infection and the response to therapy
26068923 HLA-C -35 C/C allele exerts a favorable effect on the immunological (higher baseline and nadir CD4+ T cell count) and virologic (lower pretreatment HIV viral load) variables.
25972545 RSV infection of lung epithelial cells induces expression of RIG-I, NLRC5, and subsequent upregulation of HLA-A, HLA-B and HLA-C.
25960307 Absence of HLA-C2 for donor KIR2DL1 was associated with higher grade II to IV (HR, 1.4; P = .002) and III to IV acute GVHD (HR, 1.5; P = .01) compared with HLA-C2(+) patients.
25894195 Possible protective role of human leukocyte antigen Cw7 indicates polyoma BK virus-positive people can be accepted safely for kidney donation.
25844609 this is the first molecular study of HLA typing in Egyptian patients with vitiligo
25827531 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
25794162 ). In conclusion, we found an interaction between the HLA-Cw6 and LCE genotypes on disease improvement among psoriatic patients treated with anti-TNFs.
25781986 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
25754738 relative expression levels of HLA-A, HLA-B, HLA-C, and HLA-E proteins for the specific haplotype A*02:01, B*44:02, C*05:01, which were characterized using two independent methods based on flow cytometry and mass spectrometry.
25715101 These results highlight the impact of population allele frequency on viral control and identify a novel association between HLA-C04 : 01 in combination with KIR2DS4f and uncontrolled HIV infection.
25714001 Meta-analysis of genetic association studies shows that HLA-C*04 carriage may be a common risk factor for nevirapine-induced hypersensitivity in populations of differing ethnicity.
25701112 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
25666956 Our results demonstrated the association of HLA-C*03 and HLA-DRB1*01 alleles with Macedonian autistic patients
25633660 The results show that the analysis of peptide induced HLA-C upregulation on B-LCL and T2-cells enables the efficient identification of new HLA-C restricted CTL epitopes.
25626601 The study aims to assess the distribution of HLA-A, -B, -Cw and DRB1 alleles in Moroccan patients with ankylosing spondylitis (AS) and to compare the clinical features of AS and the frequencies of HLA-B27 in patients from Morocco.
25620704 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
25589651 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
25581336 the frequencies of HLA-Cw07 were statistically significantly higher in the patient group than those in the control group (P = 0.009). KIR2DS1(+) HLA(-) Cw(Lys) was more common in subjects with SLE
25495410 Our data suggest the HLA-A*02:01:01/-B*35:01:01/-C*04:01:01 haplotype may be a biomarker for LTG-induced maculopapular exanthema and the HLA-C*08:01 allele for PHT-induced MPE.
25493653 rs4406273 is a surrogate for genotyping HLA-C*06:02 in diverse populations
25454626 the results suggest that the HLA-E and HLA-C molecules may play an important role in determination immune response contributing to the Psoriatic arthritis development.
25367742 higher frequency of HLA-C2 and a higher frequency of 14 base pair (bp) insertion in HLA-G in women with RIF.
25329633 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
25323824 HLA-C has a role in the permissibility of mismatches in hematopoietic cell transplantation
25278127 The HLA-C3 antigen and the 2-locus haplotype are associated with AML.
25275127 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
25237729 Logistic regression showed an association between HLA-C1/C1 and rapid virologic response in HCV g1 infections with an OR relative to the heterozygote of 10.0 (95% CI: 1.6-62.5, P=0.014).
25193656 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
25188020 Authors showed an increase in HLA-C1/KIR2DL2 and HLA-C1/KIR2DL3 pairs in human papillomavirus high-risk infected patients (OR 3.05, 3.24) with invasive cervical cancer (OR 1.33, 3.68).
25083782 HLA-C -35kb expression SNP is associated with differential control of beta-HPV infection in squamous cell carcinoma cases and controls.
24990997 Influenza A virus M158-66 elicited cytotoxic T lymphocyte responses in both HLA-A*02- and HLA-C*08-positive individuals.
24986480 study found no association between KIR and HLA-C and idiopathic bronchiectasis
24965469 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24951171 genetic association studies in Chinese Han population: Data suggest that the frequency of KIR2DL1 gene is increased in women with pre-eclampsia when homozygous HLA-C2 allele appears in the fetus.
24911933 combination of maternal KIR AA with fetal HLA-C2 associated with increased incidence of preeclampsia in Chinese Han population
24904546 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24842861 the interaction between KIR genes and HLA-C is important for determining antiviral immunity and contributes to the protection against or susceptibility to HBV infection.
24818561 Our findings suggest KIR2DL1(+)-HLA-C2(+) genotype as heritable risk factor in oral squamous cell carcinoma (OSCC) predisposing to OSCC at a younger age.
24791935 Show lack of correlation between HLA-C*06 and family history of psoriasis in cohort of pediatric plaque psoriasis patients.
24785948 These data show that naturally occurring sequence variations within HLA-C03:04-restricted HIV-1 p24 Gag epitopes can have a significant impact on the binding of inhibitory KIR2DL2 receptors and primary natural killer cell function.
24785948 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24778445 Effect of KIR2DS1 was most significant in pregnancies where its ligand, HLA-C2, was paternally but not maternally inherited by a fetus (p = 0.005, odds ratio = 2.65).
24759677 A single nucleotide polymorphism -35 kb T>C (rs9264942) is strongly associated with psoriasis vulgaris depending on HLA-Cw( *)06.
24755350 The strongest association for the development of epithelial ovarian cancer has been found between KIR2DL2 and HLA-C1 expression.
24748005 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24717292 Donor mismatches at HLA-C loci contributed to the development of HLA-specific antibodies in patients listed for repeat renal transplantation.
24651768 HLA-C genotypes are important determinants of conjunctival scarring in trachoma and that KIR2DL2/KIR2DL3 heterozygosity further increases risk of conjunctival scarring in individuals carrying HLA-C2.
24566686 These results provide evidence that HLA-C polymorphisms are associated with a decreased risk of Rheumatoid arthritis
24554773 Results indicate the role of HLA class I molecules HLA-A, HLA-B and HLA-C in NK cell maturation and KIR repertoire acquisition.
24495362 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24408320 Hematopoietic stem cell transplantation (HSCT) with unrelated donors (UDs) showed no association between the HLA-C allele mismatches (CAMMs) and adverse outcomes.
24400003 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24349500 combinations of KIR3DL1/HLA-Bw4, KIR2DL2/HLA-C1, and a genetic variant of the IL28B gene are predictive of the response to PEG-IFN and ribavirin therapy in Japanese patients infected with genotype 1b HCV.
24324648 SNP rs3130941 in the HLA-C region was consistently associated with total IgE levels in 3 independent Japanese populations.
24248364 a MIR148A insertion/deletion polymorphism associates with its own expression levels, affecting the extent to which HLA-C is down-regulated, the level of HIV control, and the risk of Crohn disease.
24227846 HLA-Cw0801-restricted Env171-180 T cell response is an important component of the HBV-specific adaptive T cell immunity in Asians.
24162738 Importance of HLA-C and UBE2L3 in the clearance of HBV infection in addition to HLA-DP and HLA-DQ.
24158818 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24046013 Data indicate the association of HLA-A, -B, -C, and -DRB1 incompatibilities with adverse outcome in hematopoietic stem cell transplantation (HSCT).
24041011 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24023945 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
24006284 Data suggest that the cell-surface HLA class I molecules HLA-G, HLA-E, and HLA-C co-localize with each other on trophoblast cell membranes and have the potential to form preferential heterotypic associations that may be modulated by progesterone.
23990973 Data show that HLA-Cw*0602 single nucleotide polymorphisms (SNPs) affecting HLA-Cw*0602 expression are likely to contribute to psoriasis susceptibility.
23974321 Analysis of this large cohort from Uganda in the context of other African populations reveals variations in KIR and HLA-C1 and C2 that are consistent with migrations within Africa and potential selection pressures on these genes.
23901134 HLA-C alleles confer risk for anti-citrullinated peptide antibody-positive rheumatoid arthritis independent of HLA-DRB1 alleles.
23853598 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
23853074 The results reveal a novel genetic susceptibility locus that clearly underlines the role of genetically driven, inflammatory processes in the pathogenesis of idiopathic DCM.
23847689 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
23838325 The expression of MHC class I was very low in the hippocampus at 20 (gestational weeks) GW and slowly increased at 27-33 GW. No expression of MHC class I was found in hippocampal formation in adult.
23588886 Among the 17 alleles detected, only 2 C*04:01 & C*15:02 were significantly associated with alopecia areata. C*04:01, C*07:02, & C*15:02 represented different AA genetic risk factors in each sub-phenotype.
23559252 Higher HLA-C expression was correlated with increased likelihood of cytotoxic T lymphocyte responses and frequency of HIV viral escape mutation.
23536655 Epstein-Barr virus negativity is associated with HLA-C and HLA-Bw4 variants among individuals older than 60 years.
23521149 Results underline the role of HLA-Cw6 not only as a psoriasis susceptibility gene, but also as a pharmacogenetic marker of response to ustekinumab in psoriasis
23490051 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
23462218 This study highlighted independent effects of HLA-B and HLA-C alleles on HIV-disease progression.
23398510 women with HPV-related cervical disease were found more likely to carry HLA-C*0303 and less likely to carry HLA-C*01 compared to women without HPV infection; HLA-C*0303 was found to confer susceptibility to HPV-related cervical disease; HLA-C*01 was found to confer a protective effect against HPV-related cervical disease
23390293 In a reductionist system, the presence of HLA-Cw3 reduces the frequency of KIR2DL2-expressing cells, as well as the surface expression levels of transgenic KIR2DL2.
23362284 The study has identified HLA-C*04:01 carriage as a risk factor for nevirapine-induced Stevens-Johnson syndrome/toxic epidermal necrolysis in a Malawian HIV cohort.
23330836 Association of human leukocyte antigen class I antigens in Iranian patients with pemphigus vulgaris
23289738 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
23246585 Data indicate that full length genomic sequence from a single long-range PCR amplicon for 15 common and well-documented HLA-A, HLA-B and HLA-C alleles were obtained.
23200758 Data indicate estimated HLA-A, -B, -C, -DRB1 haplotype and allele frequencies of donors within DKMS German Bone Marrow Donor Center with parentage from 17 different countries.
23184486 Susceptibility to psoriasis vulgaris is significantly associated with HLA-C*06 (odds ratio (OR) = 3.85), DRB1*07 (OR = 2.56) and DQB1*02 (OR = 1.09), respectively, whereas DRB*01 (OR = 0.05) is associated negatively.
23177929 This study demonistrated that HLA-C may increase risk for schizophrenia.
22980333 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22958291 study found that the distributions of KIR2DS3 and KIR3DS1 were more common in syphilis patients than in controls, and that the distributions of KIR2DS5, HLA-C1C1 and HLA-C1C1-KIR2DL3 were more common in healthy controls than in syphilis patients
22931917 In contrast to earlier findings, association with ERAP1 was neither dependent on nor interacting with HLA-C*06:02.
22931314 Activating KIR genes from donors were associated with distinct outcomes of allogeneic HSCT for AML. Donor KIR2DS1 appeared to provide protection against relapse in an HLA-C-dependent manner, and donor KIR3DS1 was associated with reduced mortality.
22923333 Data indicate that the peptide-loading complex (PLC) consists maximally of 2x tapasin-ERp57/MHC I per TAP complex, but one tapasin-ERp57/MHC I in the PLC is essential and sufficient for antigen processing.
22844345 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22826228 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22807681 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22803655 HLA-C 04 antigens predispose Brazilian patients to the development of severe liver damage in chronic hepatitis C virus infection.
22772445 Dominating avidity modulation of HLA-C binding sites by natural killer {NK) cell KIR receptors is position 70, with lesser contributions from positions 68 and 182. KIR2DL3 has lower avidity and broader specificity for HLA-C than KIR2DL1.
22767237 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22705789 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22651890 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22586163 HLA-B*27, HLA-B*38, HLA-B*39 and HLA-C*12 alleles are potential psoriatic arthritis-specific genetic markers among patients with psoriasis.
22569429 Study emphasizes the importance of molecular methods in identifying all possible HLA-C alleles in donors for bone marrow transplantation.
22553319 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22548719 These results demonstrate that C*07:01:01G as defined by routine sequence-based typing is a heterogeneous group of alleles, especially among individuals of African origin.
22537596 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22512642 Paediatric-onset psoriasis is associated with .... and HLA-C*06.
22510299 HLA-Cw*0602 was significantly increased in patients with early-onset psoriasis.
22509813 The frequency of the combination of HLA-C1 allele group with KIR2DS2 was significantly higher in severe dry eye disease patients.
22503975 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22474021 the protective role of HLA-C-restricted responses in nonwhites during HIV infection.
22321328 HLA-Cw*07 allele and HLA-Cw*12 allele may be strongly associated with the susceptibility of ulcerative colitis and Crohn's disease, respectively.
22301152 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22301137 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22251067 The new allele, officially designated HLA-C*04:71, differs from HLA-C*04:01:01:01 by two single-nucleotide polymorphisms
22219647 KIR2DS3 and HLA-class I alleles (-Cw*14 and -Cw*17) may play a role in the pathogenesis of the Vogt-Koyanagi-Harada disease.
22194166 The positive allele of HLA-Cw*0602 polymorphism appears to be a risk factor for psoriasis.
22185807 Our study indicates that the absence of the inhibitory KIR2DL3 gene is associated with an increased risk of developing multiple sclerosis in individuals carrying HLA-C1 alleles
22175768 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22125590 Results indicate that two SNPs rs9468925 in HLA-C/HLA-B and rs2858881 in HLA-DQA2 were repeatedly selected in all models, suggesting that multiple loci outside PSOR1 locus were associated with psoriasis.
22113476 these findings demonstrate the presence of allele-specific differences in HLA-C expression and indicate that HLA-Cw*0602 is unresponsive to upregulation by key proinflammatory cytokines in psoriasis.
22103834 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22103833 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22103831 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
22099809 Pretransplant anti-DP, but not anti-C antibodies seem to be involved more frequently in poor kidney graft outcomes
22074999 Data show that the most prevalent alleles at the four loci in the black population were A*30:01, B*58:02, C*06:02, and DRB1*13:01 and in the Caucasian population were A*02:01:01, B*07:02:01, C*07:01, and DRB1*03:01.
22069276 a combination of HLA-C1 and -C2 showed a positive association with T1D in Han Chinese.
22035606 The novel HLA-C allele found in a family of Benin origin, HLA-C*16:07:02, differs from HLA-C* 16:07:01 by a silent nucleotide substitution at codon 220 (TAC to TAT).
21985130 Records show that HLA-C has a strong influence on the clinical features and the susceptibility to psoriasis in Chinese patients.
21958371 A case-control study of the association of HLA with SARS revealed that the HLA-Cw1502 and DR0301 alleles conferred resistance against SARS infection in Taiwan.
21931540 Carriage of specific KIR genes in combination with specific HLA-C and IL28B variants was associated with an altered HCV treatment response.
21920398 genetic polymoprphism influences progression to cirrhosis in patients with chronic hepatitis C
21912600 NK-DC interaction via KIR and HLA-C immune synapse may have a central role in long-term kidney transplant outcomes
21909837 Activating combinations of KIR:HLA-C genes are more frequent in young children with type 1 diabetes diagnosed in the first 5 years of life.
21896007 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21861776 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21860345 assessed whether increases in viral load set points are associated with genetic markers in CCR5, HCP5, and HLA-C genes
21797986 KIR2DS1+HLA-C2 and KIR3DL1+HLA-B Bw4 Ile80 combinations were associated with the vulnerability to ankylosing spondylitis.
21778700 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21762823 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21732917 Characterization of 236 novel alleles at the HLA-A, -B, -C, -DRB1, -DQB1 and -DPB1 loci
21712058 Data show that a total of 49, 86, 50, 63, and 24 HLA-A, -B, -C, -DRB1, and -DQB1 alleles were observed.
21699788 HLA-Cw*1202-B*5201-DRB1*1502 haplotype increases risk for ulcerative colitis but reduces risk for Crohn's disease.
21658009 Characterization and polymorphic analysis of 4.5 kb genomic full-length HLA-C in the Chinese Han population
21625020 HLA-C is a genetic predisposing factor in definite Meniere's disease.
21585707 Full-length nucleotide sequences of 14 HLA-B alleles and 10 HLA-C alleles were obtained and Totally 157 and 167 polymorphism positions were found in the full-length genomic sequence of HLA-B and HLA-C loci respectively
21543478 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21482738 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21482733 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21412248 CSTA significantly increases the risk of developing psoriasis in HLA-Cw6 individuals
21410657 C*07:185 is a novel HLA-C*07 allele identified by sequence-based typing
21373785 KIR2DS2/KIR2DL2 and HLA-C genotype of rheumatoid arthritis patients may provide predictive information for response to anti-TNF-alpha therapy.
21352198 Data suggest that HLA class I antigens contribute to tumour antigen-specific cellular immune response most probably by mediating the interactions between tumour cells and CD8(+) T cells.
21248048 the HIV-1 protective -35 SNP genotype does not associate with increased expression of HLA-C; rather, the nonprotective allele associates with the greatly reduced expression of a single HLA-C allele, the Cw*07 allele
21209113 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21179506 Results demonstrate that receptor-ligand dimensions, NKG2D/MICA and KIR2DL1/HLA-C, are important in NK cell recognition.
21165790 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21134695 results suggest that among KIR AA women who have HLA-C C2C2 partners, HLA-C heterozygous females show a trend towards an increased chance of successful pregnancy
21107349 The analysis of the HLA-Cw6 locus showed significant differences in the epistatic interaction with the LCE3C and LCE3B deletion in at least some European populations, indicating epistatic effects between these two major genetic contributors to psoriasis.
21084992 Observational study of gene-disease association. (HuGE Navigator)
21068258 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
21059899 Observational study of gene-disease association. (HuGE Navigator)
21051598 genetic basis of HIV-1 control; identified >300 significant SNPs within the MHC; amino acids in HLA-B peptide binding groove and an independent HLA-C effect explain SNP associations
21051598 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
21049023 Observational study of gene-disease association. (HuGE Navigator)
20974205 Observational study of gene-disease association. (HuGE Navigator)
20972337 Data demonstrate that trophoblast expresses both paternally and maternally inherited HLA-C surface proteins and that maternal KIR AA frequencies are increased in affected pregnancies only when the fetus has more group 2 HLA-C genes (C2) than the mother.
20970669 Observational study of gene-disease association. (HuGE Navigator)
20953190 ERAP1 variants only influenced psoriasis susceptibility in individuals carrying the HLA-C risk allele.
20953186 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20937338 Observational study of gene-disease association. (HuGE Navigator)
20935224 Observational study of gene-disease association. (HuGE Navigator)
20931685 Observational study of gene-disease association. (HuGE Navigator)
20923372 Observational study of gene-disease association. (HuGE Navigator)
20857097 HLA-Cw group 1, which serves as ligand for certain KIR, was significantly overtransmitted in women with invasive cervical cancer, and particularly in the subgroup of women infected with high risk HPV16 or 18 subtypes.
20857097 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20798335 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20739527 HLA-C-restricted CTL responses are capable of driving viral immune escape within Gag
20713950 Observational study of gene-disease association. (HuGE Navigator)
20702582 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
20684489 Observational study of gene-disease association. (HuGE Navigator)
20678810 Observational study of gene-disease association. (HuGE Navigator)
20668555 Observational study of gene-disease association. (HuGE Navigator)
20660184 Observational study of gene-disease association. (HuGE Navigator)
20652381 genetic polymorphism contributes to pathogenesis of ankylosing spondylitis
20652381 Observational study of gene-disease association. (HuGE Navigator)
20643584 Inhibitory receptor KIR2DL1 in combination with HLA-C2 ligand confers susceptibility to chronic hepatitis B (CHB), whereas inhibitory receptor KIR2DL3 or KIR2DL3 homozygote in the presence of HLA-C1C1 genotype shows protection against CHB.
20643584 Observational study of gene-disease association. (HuGE Navigator)
20637045 Observational study of genotype prevalence. (HuGE Navigator)
20626025 HLA Cw6 was significantly expressed in psoriasis cases when compared with healthy controls (P<0.05).
20613458 Observational study of gene-disease association. (HuGE Navigator)
20608062 Observational study of gene-disease association. (HuGE Navigator)
20604894 Comparison of MHC class I risk haplotypes in Thai and Caucasian psoriatics shows locus heterogeneity at PSORS1.
20604894 Observational study of gene-disease association. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20595243 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
20594957 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
20587610 Observational study of gene-disease association. (HuGE Navigator)
20580654 Results suggest a protective role of KIR2DL1/C2 in T1D.
20580654 Observational study of gene-disease association. (HuGE Navigator)
20574122 Observational study of gene-disease association. (HuGE Navigator)
20561448 Observational study of genotype prevalence. (HuGE Navigator)
20559009 Observational study of gene-disease association. (HuGE Navigator)
20549830 Observational study of gene-disease association. (HuGE Navigator)
20547040 Observational study of gene-disease association. (HuGE Navigator)
20536993 Observational study of gene-disease association. (HuGE Navigator)
20519398 Observational study of gene-disease association. (HuGE Navigator)
20504258 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20492599 Observational study of genotype prevalence. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20492592 Observational study of genotype prevalence. (HuGE Navigator)
20483367 Data shoe that KIR2DL3-C1C2 combination was near-significantly associated with HAM/TSP outcome in the second stage.
20466636 Data show that the information of SNPs in HLA-Cw alleles can be used as resources of markers for high-resolution typing, complex diseases association studies and human evolution.
20466636 Observational study of genotype prevalence. (HuGE Navigator)
20463068 Data suggest that HIV-1 Nef may counteract HLA-C-mediated immune control in some individuals indirectly, by manipulating T-cell function and MHC-II antigen presentation.
20462405 Observational study of genotype prevalence. (HuGE Navigator)
20456039 Killer cell immunoglobulin-like receptors (KIR) are involved in the activation/inhibition of NK cells through an interaction with HLA class I molecules on target cells.
20456039 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20416195 Observational study of genotype prevalence. (HuGE Navigator)
20385791 Observational study of gene-disease association. (HuGE Navigator)
20380698 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
20356536 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20347497 The HLA-C gene shows genetic associations in Itlians with primary sclerosing cholangitis.
20347497 Observational study of gene-disease association. (HuGE Navigator)
20335219 Observational study of gene-disease association. (HuGE Navigator)
20334121 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20235791 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20230525 Observational study of genotype prevalence. (HuGE Navigator)
20224785 Observational study of gene-disease association. (HuGE Navigator)
20219611 Observational study of genotype prevalence. (HuGE Navigator)
20210919 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
20193031 Observational study of genotype prevalence. (HuGE Navigator)
20173792 Observational study of gene-disease association. (HuGE Navigator)
20173784 Observational study of gene-disease association. (HuGE Navigator)
20169624 Observational study of gene-disease association. (HuGE Navigator)
20145915 Observational study of gene-disease association. (HuGE Navigator)
20137308 Observational study of gene-disease association. (HuGE Navigator)
20097244 Observational study of genotype prevalence. (HuGE Navigator)
20090103 Observational study of gene-disease association. (HuGE Navigator)
20082621 Observational study of gene-disease association. (HuGE Navigator)
20082482 Observational study of gene-disease association. (HuGE Navigator)
20077564 KIR and HLA-C protection in both treatment response and spontaneously resolving HCV was validated at the allelic level, in which KIR2DL3-HLA-Cw*03 was associated with sustained virological response (SVR)(P = 0.004, OR = 3.4, 95% CI = 1.5-8.7).
20077564 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20073992 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20065064 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
20056126 Data show that KIR activation and HLA expression density are critical determinants for the efficacy of rituximab treatment.
20016497 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20012528 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
20012522 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
20003137 Observational study of genotype prevalence. (HuGE Navigator)
19968064 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19936734 Iranian populations:the Azerbaijanis at high altitude and the Jonobi people at sea level; differences were seen in KIR and HLA-C group frequencies, in linkage disequilibrium and inhibitory/activating KIR ratios between the groups.
19936734 Observational study of genotype prevalence. (HuGE Navigator)
19935663 the -35C allele is a proxy for high HLA-C cell surface expression, and that individuals with high-expressing HLA-C alleles progress more slowly to AIDS and control viremia significantly better than individuals with low HLA-C expressing alleles.
19934297 Observational study of gene-disease association. (HuGE Navigator)
19932885 Observational study of gene-disease association. (HuGE Navigator)
19931565 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19925877 Observational study of gene-disease association. (HuGE Navigator)
19924143 Observational study of gene-disease association. (HuGE Navigator)
19912639 Observational study of gene-disease association. (HuGE Navigator)
19907433 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19898503 Observational study of gene-disease association. (HuGE Navigator)
19896518 Observational study of gene-disease association. (HuGE Navigator)
19874367 Observational study of gene-disease association and genetic testing. (HuGE Navigator)
19861144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19850842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19847956 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19846535 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19845952 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19845915 Observational study of genotype prevalence. (HuGE Navigator)
19843037 models of allogeneic interactions showed that targets co-expressing HLA C1 and C2 epitopes best supported, or even enhanced, this cell-contact-mediated regulatory NK cell function
19830740 Data show that sHLA-Cw4 or sHLA-Cw3 alleles induced secretion of TGF-beta1 by ligation of stimulatory KIR2DS1 or KIR2DS2 isoforms.
19789864 The KIR2DL2, KIR2DL3 genotype is predisposing to Crohn's disease in the presence of C1 ligand. C2 ligand is protective. Heterozygote susceptibility is intermediate.
19776241 Infectability by HIV was significantly reduced (P=0.016) in silenced cells compared with cells that maintained HLA-C expression in 10 of the 11 peripheral blood lymphocyte donors.
19776241 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19774073 Observational study of gene-disease association. (HuGE Navigator)
19770068 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19762282 sHLA-G and sHLA-A, -B, -C serum levels were significantly elevated in HIV-infected subjects as compared with controls before antiretroviral treatment and significantly decreased after 36 months of HAART.
19758198 Studies revealed that HLA-DRB1*1501 association was with CDLE and SLE, and association between HLA-Cw6 and CDLE was first reported in a Japanese population.
19744147 Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1.
19728333 Data showed HLA-G upregulation and MHC class I downregulation in neoplastic cells.
19703234 Observational study of genotype prevalence. (HuGE Navigator)
19694795 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19693088 findings suggest a pattern of strong linkage disequilibrium consistent with an HLA-B/-C haplotype block, making identification of a causal variant difficult.
19693088 Observational study of gene-disease association. (HuGE Navigator)
19683555 Observational study of gene-disease association. (HuGE Navigator)
19680446 HLA-C alleles were associated with psoriasis.
19680446 Observational study of gene-disease association. (HuGE Navigator)
19668019 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19667963 Observational study of gene-disease association. (HuGE Navigator)
19663932 Observational study of gene-disease association. (HuGE Navigator)
19663693 Observational study of gene-disease association. (HuGE Navigator)
19656140 significance of donor HLA-C genotyping in liver transplantation
19654877 Observational study of gene-disease association. (HuGE Navigator)
19654407 Observational study of gene-disease association. (HuGE Navigator)
19653987 Observational study of gene-disease association. (HuGE Navigator)
19643141 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19631389 HLA-C mismatched pregnancies exhibit a decidual lymphocyte response to fetal cells and contain functional CD4+CD25bright regulatory T cells in decidual tissue
19630074 Observational study of gene-disease association. (HuGE Navigator)
19589487 Observational study of gene-disease association. (HuGE Navigator)
19574026 Observational study of gene-disease association. (HuGE Navigator)
19571811 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19555986 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19552960 Findings in HCV-infected and non-infected IDUs suggest an important role for KIRs (KIR2DL2 and KIR2DL3) with group HLA-C1 molecules, in the presence of activating KIR2DS4, in protection from HCV infection.
19552960 Observational study of gene-disease association. (HuGE Navigator)
19549379 The less the KIR/HLA-Cw matched, the more cytotoxic activity was shown in NK cells.
19544559 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19539218 Observational study of gene-disease association. (HuGE Navigator)
19525279 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19493233 Observational study of genotype prevalence. (HuGE Navigator)
19493232 Observational study of gene-disease association. (HuGE Navigator)
19487887 This study showed that significant decressed expression of HLA-C genotypes in patients with human high-grade gliomas in Sicily.
19487887 Observational study of gene-disease association. (HuGE Navigator)
19480851 Observational study of genotype prevalence. (HuGE Navigator)
19480679 among HLA-Cw*0602 positive psoriasis patients, streptococci may contribute to the onset or exacerbation of the inflammatory process independent of the disease phenotype
19480679 Observational study of gene-disease association. (HuGE Navigator)
19449444 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19409091 Observational study of gene-disease association. (HuGE Navigator)
19407364 Observational study of gene-disease association. (HuGE Navigator)
19392983 cannot confirm a major role of donor HLA-C2 genotype on long-term allograft survival after liver transplantation
19392983 Observational study of gene-disease association. (HuGE Navigator)
19364514 Observational study of genotype prevalence. (HuGE Navigator)
19350523 Observational study of genotype prevalence. (HuGE Navigator)
19349081 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19326408 Observational study of gene-disease association. (HuGE Navigator)
19299434 Observational study of gene-disease association. (HuGE Navigator)
19276793 Observational study of gene-disease association. (HuGE Navigator)
19275586 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19262574 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19246116 Observational study of gene-disease association. (HuGE Navigator)
19242058 Observational study of gene-disease association. (HuGE Navigator)
19232441 Observational study of gene-disease association. (HuGE Navigator)
19227412 Observational study of gene-disease association. (HuGE Navigator)
19214504 Observational study of gene-disease association. (HuGE Navigator)
19200845 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19200828 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19196481 Observational study of gene-disease association. (HuGE Navigator)
19184033 Observational study of gene-disease association. (HuGE Navigator)
19181658 Observational study of gene-disease association. (HuGE Navigator)
19180512 Observational study of gene-disease association. (HuGE Navigator)
19169284 Observational study of gene-disease association. (HuGE Navigator)
19169254 Expanded catalog of genetic loci implicated in psoriasis susceptibility.
19169253 LCE3C_LCE3B-del shows epistatic effects with the HLA-Cw6 allele on the development of psoriasis.
19169253 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19159415 Observational study of gene-disease association. (HuGE Navigator)
19149577 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
19143818 Observational study of gene-disease association. (HuGE Navigator)
19143812 Observational study of gene-disease association. (HuGE Navigator)
19120281 Observational study of gene-disease association. (HuGE Navigator)
19104471 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19096254 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19054371 Observational study of genotype prevalence. (HuGE Navigator)
19050382 Observational study of gene-disease association. (HuGE Navigator)
19046302 a combination KIR2DL2- HLA-C1 plays a critical role in susceptibility or protection in Latvians against type 1 diabetes.
19046302 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19032228 Observational study of gene-disease association. (HuGE Navigator)
19023492 Observational study of gene-disease association. (HuGE Navigator)
19019964 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19000140 Observational study of genotype prevalence. (HuGE Navigator)
18997170 Of 159 AA substitutions at 55 positions in hematologic neoplasm patients with HSCT, 3 specific ones were responsible for a decreased risk of relapse: Ser9C-Tyr9C, Phe99C-Tyr99C,& Arg156C-Leu156C.
18997170 Observational study of gene-disease association. (HuGE Navigator)
18987136 These data suggest that HLA-C is involved in the attachment of HCoV-HKU1 to A549 cells and is a potential candidate to facilitate cell entry.
18982067 Data demonstrate that the influence of ZNRD1 alleles on disease progression rates are attributable to HLA-A10, help clarify the relationship between the HCP5, HLA-C and HLA-B*57 alleles, and reaffirm a critical role of HLA-B*57 alleles in HIV disease.
18982067 Observational study of gene-disease association. (HuGE Navigator)
18976440 Observational study of gene-disease association. (HuGE Navigator)
18976432 Observational study of genotype prevalence. (HuGE Navigator)
18958335 Observational study of gene-disease association. (HuGE Navigator)
18922348 Present results suggest that there is a significant relationship between nasal polyposis and HLA-Cw allele frequency among the Turkish population.
18922348 Observational study of gene-disease association. (HuGE Navigator)
18852273 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18848853 Observational study of genotype prevalence. (HuGE Navigator)
18808677 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18800148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18782112 Soluble HLA-C serum level is significantly increased in allergic rhinitis patients with pollen allergy.
18778326 Observational study of gene-disease association. (HuGE Navigator)
18768435 Observational study of gene-disease association. (HuGE Navigator)
18725938 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18702622 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18684953 Observational study of gene-disease association. (HuGE Navigator)
18673537 HLA-C molecules associate with HIV gp120 and increase the infectivity of both R5 and X4 viruses.
18673537 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18672082 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18671674 Tissue donor HLA-C genotype has a profound impact on the clinical outcome following liver transplantation.
18671674 Observational study of gene-disease association. (HuGE Navigator)
18653452 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18643961 These results suggest that activating KIR2DS1 gene may not confer susceptibility to PV, and an association of KIR2DS1 gene with the HLA-Cw*0602+ was observed in these patients.
18643961 Observational study of gene-disease association. (HuGE Navigator)
18627572 Observational study of gene-disease association. (HuGE Navigator)
18596105 Observational study of gene-disease association. (HuGE Navigator)
18585007 HLA-Cw6, overweight and higher waist-hip ratio are material risk factors of psoriasis vulgaris, especially the combined effects of HLA-Cw6 and BMI, WHR on psoriasis vulgaris in Chinese population.
18585007 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18580606 Observational study of gene-disease association. (HuGE Navigator)
18571006 Observational study of gene-disease association. (HuGE Navigator)
18566368 selective up-regulation of maternal killer Ig-like receptor has functional consequences because uterine NK cells show increased binding of HLA-C tetramers compared with blood NK cells
18544086 Observational study of gene-disease association. (HuGE Navigator)
18543232 Data suggest that in spite of HLA-Cw heterogeneity, remarkable similarities may exist between Han populations in China at the combinational level of HLA-Cw and KIR2D, which are characterized by preponderant inhibitory signal pathways.
18543232 Observational study of genotype prevalence. (HuGE Navigator)
18523244 Tightly regulated HLA-C surface expression via the activity of an internalization and lysosomal targeting signal facilitates immune surveillance and allows HLA-C to serve a specialized role in macrophages.
18521626 Observational study of gene-disease association. (HuGE Navigator)
18515573 The HLA-Cw*0701 allele and KIR haplotype AA are associated with AMD. This genotype combination suggests that natural killer cells have a role in the pathogenesis of AMD.
18496418 Observational study of gene-disease association. (HuGE Navigator)
18486765 Observational study of gene-disease association. (HuGE Navigator)
18451182 Co-occurring HLA alleles across loci seem to be more important than individual allelesin squamous cell cervical cancer risk.
18451182 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18438604 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18434400 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18434400 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18420581 N-linked glycosylation selectively regulates the generic folding of HLA-Cw1
18396213 Observational study of gene-disease association. (HuGE Navigator)
18385790 Observational study of gene-disease association. (HuGE Navigator)
18381784 Certain HLA alleles are found in Chinese patients with psoriasis (HLA-A*30, -Cw*06, -DR*07) and psoriatic arthritis (PsA) (HLA-B*27). Psoriasis patients with the HLA-B*27 and/or -Cw*12 may have higher risk of developing PsA.
18381784 Observational study of gene-disease association. (HuGE Navigator)
18369457 By performing family-based association analyses of haplotypes as well as an exclusion analysis of recombinant haplotypes, we refined the PSORS1 gene to a small critical region where HLA-C is a strong candidate to be the PSORS1 susceptibility gene.
18369457 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18364739 Observational study of gene-disease association. (HuGE Navigator)
18347914 Observational study of gene-disease association. (HuGE Navigator)
18340360 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18332066 Observational study of gene-disease association. (HuGE Navigator)
18329312 Observational study of gene-disease association. (HuGE Navigator)
18315912 Observational study of gene-disease association. (HuGE Navigator)
18309376 Study show additional risk loci for rheumatoid arthritis are present SNP alleles found on the conserved A1-B8-DR3 (8.1) haplotype show the strongest evidence of positive association (P ~ 0.00005) clustered in the region around the HLA-C locus.
18309376 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18301962 Observational study of gene-disease association. (HuGE Navigator)
18297378 Observational study of gene-disease association. (HuGE Navigator)
18296443 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18289678 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18263639 Observational study of gene-disease association. (HuGE Navigator)
18219280 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18186800 Observational study of genotype prevalence. (HuGE Navigator)
18097038 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18091530 Observational study of gene-disease association. (HuGE Navigator)
18086268 This report describes the unknown exon 4 sequence of the rare human leukocyte antigen-Cw*0716 allele, identified in a Caucasian renal transplant recipient from Italy.
18086267 Observational study of genotype prevalence. (HuGE Navigator)
18082573 Observational study of genotype prevalence. (HuGE Navigator)
18075513 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18074415 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18070207 Observational study of gene-disease association. (HuGE Navigator)
18069932 The novel HLA-Cw allele HLA-Cw*0751 was reported.
18064508 polymorphisms in some alleles of B and C in HLA class I genes are associated with Kawasaki disease in Korean children.
18064508 Observational study of gene-disease association. (HuGE Navigator)
18057255 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18005690 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18005680 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
18005090 HLA-Cw*0220 sequence alignment with classical and nonclassical HLA class I alleles shows that histidine-169 is shared by HLA-E and -G alleles.
17997746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17990989 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17971053 Two new HLA-C alleles, Cw*0333 and Cw*0217, identified in a black South African population appear to have arisen by missense mutations, respectively, from the HLA-B*5801-Cw*0302 and B*080101-Cw*0205 haplotypes.
17971052 Observational study of gene-disease association. (HuGE Navigator)
17964196 Observational study of gene-disease association. (HuGE Navigator)
17956696 Observational study of genotype prevalence. (HuGE Navigator)
17950922 Observational study of gene-disease association. (HuGE Navigator)
17939409 HLA-Cw mismatched in donor and recipient of hematopoietic stem cell transplantation is beneficial for reducing II-IV aGVHD.
17927716 Observational study of gene-disease association. (HuGE Navigator)
17911430 Observational study of gene-disease association. (HuGE Navigator)
17909631 Observational study of gene-disease association. (HuGE Navigator)
17900288 Observational study of genotype prevalence. (HuGE Navigator)
17878955 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
17878941 Observational study of gene-disease association. (HuGE Navigator)
17869653 Observational study of genotype prevalence. (HuGE Navigator)
17868255 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17785583 Observational study of gene-disease association. (HuGE Navigator)
17728335 Observational study of gene-disease association. (HuGE Navigator)
17726164 Observational study of gene-disease association. (HuGE Navigator)
17714418 Maternal KIR/fetal HLA-Cw gene combinations that are involved in the fetomaternal tolerance do not appear to play a role in the HPA-1a alloimmunization.
17714418 Observational study of gene-disease association. (HuGE Navigator)
17666781 Our results confirm no association between HLA-C alleles and LOP in the northern Polish population. The lack of this association supports the hypothesis about different genetic backgrounds of early- and late-onset psoriasis.
17661908 Observational study of gene-disease association. (HuGE Navigator)
17652849 Observational study of gene-disease association. (HuGE Navigator)
17652849 HLA-Cw*08 correlates with low cytotoxic T lymphocyte immune response in human T cell lymphotropic virus type I-associated myelopathy/tropical spastic paraparesis patients.
17641165 Observational study of gene-disease association. (HuGE Navigator)
17632570 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
17632197 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
17617375 Observational study of gene-disease association. (HuGE Navigator)
17604883 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
17604825 Observational study of gene-disease association. (HuGE Navigator)
17598037 Observational study of gene-disease association. (HuGE Navigator)
17598037 study showed that Cw*0602-positive patients had some obvious clinical differences from Cw*0602-negative patients in a Han Chinese population, which provides evidence for an HLA-Cw*0602-associated phenotype in psoriasis
17597093 evidence of a primary association of HLA-C, and to a lesser extent HLA-B, with Graves' disease
17586321 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
17581864 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
17578051 Observational study of gene-disease association. (HuGE Navigator)
17573956 Observational study of gene-disease association. (HuGE Navigator)
17554059 Observational study of gene-disease association. (HuGE Navigator)
17530646 Observational study of gene-disease association. (HuGE Navigator)
17530646 While the previously reported association between TNF*-238A and psoriasis seems to primarily reflect linkage disequilibrium with PSORS1, TNF*-857T may represent a risk factor for psoriatic arthritis that is independent of the PSORS1 allele.
17523949 Observational study of gene-disease association. (HuGE Navigator)
17509453 Observational study of genotype prevalence. (HuGE Navigator)
17504510 Observational study of genotype prevalence. (HuGE Navigator)
17498269 Observational study of gene-disease association. (HuGE Navigator)
17491685 Meta-analysis of gene-disease association. (HuGE Navigator)
17489060 Observational study of gene-disease association. (HuGE Navigator)
17480220 Observational study of gene-disease association. (HuGE Navigator)
17471440 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17462512 Observational study of genotype prevalence. (HuGE Navigator)
17462512 The genetic distance (GD) estimated according to HLA-A, -B, and -C allele frequency indicates that Mongolian and Hui have the closest relationship.
17462511 Observational study of genotype prevalence. (HuGE Navigator)
17407088 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17392574 Observational study of gene-disease association. (HuGE Navigator)
17389029 the HLA-Cw*1609 allele differs from the closest Cw*1602 by only one nucleotide (C --> G) at position 244 in exon 2
17388919 Observational study of gene-disease association. (HuGE Navigator)
17383044 Observational study of gene-disease association. (HuGE Navigator)
17378697 Observational study of gene-disease association. (HuGE Navigator)
17373939 Observational study of genotype prevalence. (HuGE Navigator)
17340018 Observational study of gene-disease association. (HuGE Navigator)
17317585 Observational study of gene-disease association. (HuGE Navigator)
17311253 Observational study of gene-disease association. (HuGE Navigator)
17309450 Observational study of gene-disease association. (HuGE Navigator)
17258541 Observational study of gene-disease association. (HuGE Navigator)
17252545 Observational study of gene-disease association. (HuGE Navigator)
17234427 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17223660 Observational study of gene-disease association. (HuGE Navigator)
17212710 Observational study of genotype prevalence. (HuGE Navigator)
17207712 Observational study of gene-disease association. (HuGE Navigator)
17207712 HLA-Cw*07 allele carried by the liver transplant recipient is negatively associated with acute rejection development and could be considered a predictive factor for liver graft acceptance.
17197830 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17170457 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
17166285 Observational study of gene-disease association. (HuGE Navigator)
17117954 Observational study of genotype prevalence. (HuGE Navigator)
17106278 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
17101473 Observational study of gene-disease association. (HuGE Navigator)
17085834 Observational study of gene-disease association. (HuGE Navigator)
17082605 The level of expression of target cell HLA-C determines the extent to which it segregates from ICAM-1 at the immune synapse.
17062033 Observational study of gene-disease association. (HuGE Navigator)
17029201 Observational study of genotype prevalence. (HuGE Navigator)
17026471 Observational study of genotype prevalence. (HuGE Navigator)
17021767 Observational study of gene-disease association. (HuGE Navigator)
17021767 results for antigens and allele frequency of various HLA Loci in vitiligo patients and control subjects suggested that HLA-B7, Bw6, Cw6, Cw7, and DRB4*010101 could be susceptible to vitiligo
16947780 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16929347 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16922942 Observational study of gene-disease association. (HuGE Navigator)
16890179 Observational study of gene-disease association. (HuGE Navigator)
16866883 Observational study of genotype prevalence. (HuGE Navigator)
16857416 Observational study of gene-disease association. (HuGE Navigator)
16829306 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16788244 Observational study of gene-disease association. (HuGE Navigator)
16720218 Two novel HLA-C alleles Cw*070105 and Cw*1403 were reported.
16720212 Observational study of gene-disease association. (HuGE Navigator)
16642438 Observational study of gene-disease association. (HuGE Navigator)
16642438 These results strongly suggest that HLA-Cw6 is the PSORS1 risk allele that confers susceptibility to early-onset psoriasis.
16634885 Observational study of gene-disease association. (HuGE Navigator)
16609350 Observational study of gene-disease association. (HuGE Navigator)
16571411 Observational study of gene-disease association. (HuGE Navigator)
16532100 Observational study of gene-disease association. (HuGE Navigator)
16532020 HLA-C mismatch is associated with inferior survival after myeloablative unrelated donor (URD) hematopoietic stem cell transplantation in hematologic cancers.
16490887 Observational study of gene-disease association. (HuGE Navigator)
16490887 The HLA-Cw4 allele can act as a protector against the development of MG, as it occurs less frequently in the population with MG, and those with this allele develop smaller goiters with no intrathoracic component.
16489264 Observational study of gene-disease association. (HuGE Navigator)
16459714 Intrathecal production and fluctuations in CSF and serum concentrations of sHLA-I were reciprocal in multiple sclerosis.
16455884 Carrying a Cw*0801 HLA allele is a risk factor for SARS-CoV infection susceptibility [Cw*0801 HLA]
16451198 Observational study of genotype prevalence. (HuGE Navigator)
16441500 Identification of two novel HLA-C alleles, HLA-Cw*1217 and HLA-Cw*030404
16439971 Observational study of gene-disease association. (HuGE Navigator)
16405603 Observational study of gene-disease association. (HuGE Navigator)
16365741 Observational study of gene-disease association. (HuGE Navigator)
16365741 study of the HLA-C locus revealed that the analysis of the dimorphism at position 80 in the alpha1 helix may help to evaluate the risk and prognosis of melanoma in a Spanish population
16339849 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16331567 HLA-Cw allele frequency distributions were consistent with the Hardy-Weinberg equilibrium in a group of indigenous Hans in Shenyang, China.
16331567 Observational study of genotype prevalence. (HuGE Navigator)
16331510 Observational study of gene-disease association. (HuGE Navigator)
16313304 Observational study of gene-disease association. (HuGE Navigator)
16297191 Observational study of gene-disease association. (HuGE Navigator)
16284396 Observational study of gene-disease association. (HuGE Navigator)
16281939 Observational study of gene-disease association. (HuGE Navigator)
16272320 preferential association of L31-reactive, beta2m-free H chains with calnexin in beta2m-defective cells, and with calreticulin and TAP in beta2m-expressing cells
16272310 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
16267409 Observational study of gene-disease association. (HuGE Navigator)
16216678 Observational study of genotype prevalence. (HuGE Navigator)
16215732 Observational study of genetic testing. (HuGE Navigator)
16185849 Observational study of gene-disease association. (HuGE Navigator)
16185325 Observational study of genotype prevalence. (HuGE Navigator)
16185272 Observational study of gene-disease association. (HuGE Navigator)
16129034 Observational study of gene-disease association. (HuGE Navigator)
16103458 Observational study of gene-disease association. (HuGE Navigator)
16101836 HLA-Cw*010203 is a novel HLA-Cw*01 allele identified by sequence-based typing
16091223 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
16086295 Guangdong Han population in China has twelve HLA-A, 23 B, 11 Cw and 13 DRB1 alleles and a total of 9 HLA-A-B, 20 Cw-B, 7 A-Cw, and 8 A-DRB1, 9 B-DRB1, 10 Cw-DRB1 haplotypes.
16029431 Observational study of genetic testing. (HuGE Navigator)
16029332 Observational study of gene-disease association. (HuGE Navigator)
16026588 defined Cw alleles in 91 individuals from the Maratha community of Mumbai, Maharashtra, western India
16019679 Observational study of gene-disease association. (HuGE Navigator)
15982262 analysis of novel allele HLA-Cw*1210 and confirmation of HLA-Cw*080102
15982258 new HLA class I alleles found in Caucasian population: A*3012, B*270505, B*3541 and Cw*0716
15953084 Observational study of gene-disease association. (HuGE Navigator)
15943912 Observational study of gene-disease association. (HuGE Navigator)
15943912 An examination of the association between HLA-C (Ala-73 and Asp-9) and susceptibility to psoriasis among Saudi patients.
15940053 Observational study of gene-disease association. (HuGE Navigator)
15896209 analysis of novel allele HLA-Cw*160102
15896208 analysis of novel allele HLA-Cw*0208
15854032 Observational study of gene-disease association. (HuGE Navigator)
15853898 Observational study of genotype prevalence. (HuGE Navigator)
15848982 Observational study of gene-disease association. (HuGE Navigator)
15848982 we have identified a novel gene, PSORS1C3, and characterized it with regard to psoriasis
15807454 Observational study of gene-disease association. (HuGE Navigator)
15751651 Observational study of genotype prevalence. (HuGE Navigator)
15743917 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15737195 CTGGAC haplotype is a single-point score haplotypes telomeric to HLA-C and gives a 1 df, chi2 of 50.27 (p<0.0001).
15683420 Observational study of gene-disease association. (HuGE Navigator)
15662734 Observational study of gene-disease association. (HuGE Navigator)
15654960 Observational study of gene-disease association. (HuGE Navigator)
15654960 PSORS1 is not a major inherited risk factor in the pathogenesis of late onset psoriasis
15654959 an endogenous retroviral dUTPase constitutes a candidate gene for the PSORS1 mutation.
15650879 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15639927 Observational study of genotype prevalence. (HuGE Navigator)
15638726 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
15603879 Observational study of gene-disease association. (HuGE Navigator)
15554365 Observational study of gene-disease association. (HuGE Navigator)
15546341 Observational study of genotype prevalence. (HuGE Navigator)
15539411 Observational study of gene-disease association. (HuGE Navigator)
15535834 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15534563 Observational study of genotype prevalence. (HuGE Navigator)
15523160 Observational study of gene-disease association. (HuGE Navigator)
15496201 Observational study of genotype prevalence. (HuGE Navigator)
15480178 Observational study of gene-disease association. (HuGE Navigator)
15361135 Observational study of genotype prevalence. (HuGE Navigator)
15323271 Observational study of gene-disease association. (HuGE Navigator)
15321756 Observational study of genotype prevalence. (HuGE Navigator)
15316337 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
15310528 Observational study of gene-disease association. (HuGE Navigator)
15307871 Observational study of gene-disease association. (HuGE Navigator)
15304010 Observational study of genetic testing. (HuGE Navigator)
15301865 Observational study of gene-disease association. (HuGE Navigator)
15301865 A strong asociation between the HLA Cw*04 haplotype and persistent hepatitis C virus infection was observed (p = 0.006).
15300630 The data suggest that the microsatellite instability (MSI) and loss of heterozygosity (LOH) of HLA class I gene might participate in the carcinogenesis of cervical carcinoma.
15297676 results show that genes encoding the inhibitory NK cell receptor KIR2DL3 and its human leukocyte antigen C group 1 (HLA-C1) ligand directly influence resolution of hepatitis C virus (HCV) infection
15251317 Observational study of genotype prevalence. (HuGE Navigator)
15245541 Observational study of gene-disease association. (HuGE Navigator)
15245377 Observational study of genotype prevalence. (HuGE Navigator)
15245373 Observational study of genotype prevalence. (HuGE Navigator)
15239092 Observational study of gene-disease association. (HuGE Navigator)
15220037 Observational study of gene-disease association. (HuGE Navigator)
15214895 Observational study of gene-disease association. (HuGE Navigator)
15211110 Observational study of gene-disease association. (HuGE Navigator)
15191952 Observational study of gene-disease association. (HuGE Navigator)
15191523 Observational study of genotype prevalence. (HuGE Navigator)
15191522 protective gene telomeric to the HLA-C locus in psoriasis vulgaris
15140038 Observational study of genotype prevalence. (HuGE Navigator)
15140030 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15128924 Observational study of gene-disease association. (HuGE Navigator)
15124939 Observational study of gene-disease association. (HuGE Navigator)
15122136 Observational study of gene-disease association. (HuGE Navigator)
15086350 Observational study of gene-disease association. (HuGE Navigator)
15078178 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
15072129 Observational study of gene-disease association. (HuGE Navigator)
15061705 Observational study of gene-disease association. (HuGE Navigator)
15057902 Observational study of gene-disease association. (HuGE Navigator)
15009808 Observational study of gene-disease association. (HuGE Navigator)
15009803 Observational study of genotype prevalence. (HuGE Navigator)
14965316 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
14727382 Observational study of gene-disease association. (HuGE Navigator)
14719207 Observational study of gene-disease association. (HuGE Navigator)
14716759 Observational study of gene-disease association. (HuGE Navigator)
14716759 a relation between HLA-Cw7 and differentiated thyroid carcinoma
14705987 Observational study of genotype prevalence. (HuGE Navigator)
14700599 Observational study of genotype prevalence. (HuGE Navigator)
14675183 Based on the observations that HCR is detected in cancers of epithelial origin in Ki67-negative areas and that interferon-gamma downregulates its expression, it may have an antiproliferative function.
14674935 Observational study of gene-disease association. (HuGE Navigator)
14626512 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14617038 Observational study of genotype prevalence. (HuGE Navigator)
14595379 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
14581545 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14551034 Observational study of gene-disease association. (HuGE Navigator)
14527733 Observational study of gene-disease association. (HuGE Navigator)
14501803 HLA-Cw*1507 association with HIV infection reported for the first time in Maharashtra, India
14501786 Observational study of gene-disease association. (HuGE Navigator)
12975536 Observational study of gene-disease association. (HuGE Navigator)
12962836 Observational study of gene-disease association. (HuGE Navigator)
12956875 Observational study of gene-disease association. (HuGE Navigator)
12941076 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12870022 Observational study of genotype prevalence. (HuGE Navigator)
12836198 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
12825172 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12776912 Observational study of genotype prevalence. (HuGE Navigator)
12774051 Observational study of gene-disease association. (HuGE Navigator)
12753667 Observational study of genotype prevalence. (HuGE Navigator)
12734410 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
12730526 Observational study of gene-disease association. (HuGE Navigator)
12709815 Our results confirmed the published linkage with the PSORS1 locus, as well as the PSORS2 locus, which has not been previously shown in the Chinese population.
12665835 Observational study of gene-disease association. (HuGE Navigator)
12651075 Observational study of gene-disease association. (HuGE Navigator)
12648281 Observational study of genotype prevalence. (HuGE Navigator)
12622774 Cloning and sequencing of full-length HLA-C genes
12619017 the HLA-C locus may play a role in liver graft alloreactivity or allotolerance and, therefore, may be useful to avoid acute rejection and to achieve graft acceptance, resulting in a better final outcome in liver transplantation.
12590984 Observational study of genotype prevalence. (HuGE Navigator)
12588373 Observational study of gene-disease association. (HuGE Navigator)
12574360 Observational study of gene-disease association. (HuGE Navigator)
12526811 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
12505198 Observational study of gene-disease association. (HuGE Navigator)
12472658 Observational study of genotype prevalence, gene-disease association, and gene-gene interaction. (HuGE Navigator)
12472658 Psoriasis is associated with a SNP haplotype of the corneodesmosin gene. A psoriasis susceptibility locus has been mapped to the HLA region in the proximity of the HLA-C locus.
12472657 Observational study of genotype prevalence. (HuGE Navigator)
12445319 Observational study of genotype prevalence. (HuGE Navigator)
12445315 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12427289 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
12414957 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
12392856 Observational study of gene-disease association. (HuGE Navigator)
12372094 Observational study of gene-disease association. (HuGE Navigator)
12352262 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12296785 Observational study of gene-disease association. (HuGE Navigator)
12195346 Observational study of gene-disease association. (HuGE Navigator)
12148091 Family-based analysis using a dense single-nucleotide polymorphism-based map defines genetic variation at PSORS1, the major psoriasis-susceptibility locus
12115024 Observational study of gene-disease association. (HuGE Navigator)
12100686 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12072195 Molecular diversity of the HLA-C gene identified in a caucasian population
12039411 results indicate that the HLA-Cw*0409N allele may produce a putative long HLA-Cw4 heavy chain that is not expressed on the cell surface
12028535 Elongation of the cytoplasmic domain, due to a point deletion at exon 7, results in an HLA-C null allele, Cw*0409 N
12022360 Observational study of gene-disease association. (HuGE Navigator)
12011375 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12011375 An association between young age of onset of psoriasis and HLA-Cw*0602 is confirmed in patients with psoriatic arthritis.
12010826 Observational study of gene-disease association. (HuGE Navigator)
11984513 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11972880 Sequence of two new HLA-Cw alleles: HLA-Cw*0313 and HLA-Cw*1208.
11972879 identification of new allele, Cw*0408
11967296 Observational study of gene-disease association. (HuGE Navigator)
11932387 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
11927505 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
11904677 Observational study of genotype prevalence. (HuGE Navigator)
11888582 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11875053 This is the major genetic determinant for psoriasis. The HCR gene at this locus is the putative susceptibility gene for psoriasis.
11861287 Soluble HLA class I molecules induce natural killer cell apoptosis through the engagement of CD8. HLA-A2, -Cw4, and -Bw46 alleles, or HLA-G1 leads to NK cell apoptosis.
11841366 Observational study of gene-disease association. (HuGE Navigator)
11751963 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
11578695 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
11574100 Observational study of gene-disease association. (HuGE Navigator)
11543903 Observational study of genotype prevalence. (HuGE Navigator)
11543893 Observational study of genotype prevalence. (HuGE Navigator)
11543892 Observational study of genotype prevalence. (HuGE Navigator)
11463741 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
11390038 Observational study of gene-disease association. (HuGE Navigator)
11348465 Observational study of gene-disease association. (HuGE Navigator)
11289809 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
11222331 Observational study of gene-disease association. (HuGE Navigator)
11182228 Observational study of genotype prevalence. (HuGE Navigator)
11181188 Observational study of gene-disease association. (HuGE Navigator)
11169245 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11169242 Observational study of genotype prevalence. (HuGE Navigator)
11169240 Observational study of genotype prevalence. (HuGE Navigator)
11144289 Observational study of genotype prevalence. (HuGE Navigator)
11120862 Observational study of gene-disease association. (HuGE Navigator)
11064107 Observational study of gene-disease association. (HuGE Navigator)
11053636 Observational study of gene-environment interaction. (HuGE Navigator)
10982373 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
10954160 Observational study of genotype prevalence. (HuGE Navigator)
10799863 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
10707087 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
10684310 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
10546855 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
10366557 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9840288 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9751712 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9698101 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9586638 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9582271 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9373217 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9263011 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9120272 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9104816 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
9052838 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
8877415 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
8671651 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
8612235 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
8493575 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
8084338 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
7913356 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
7677956 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
7621073 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
7539755 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
2789433 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells
1316930 Antisense reading frame-derived cryptic epitopes from the gag, pol, and nef genes are inhibited by the predicted HLA-I alleles, and presented by HIV-1-infected CD8+ T-cells

AA Sequence

MRVMAPRTLILLLSGALALTETWACSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE      1 - 70
PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQS     71 - 140
AYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQWRAYLEGTCVEWLRRYLENGKETLQRAEHPK    141 - 210
THVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVMAVVMCRRKSSGGKGGSCSQAAS    281 - 350
SNSAQGSDESLIACKA                                                          351 - 366
//

Text Mined References (758)

PMID Year Title
26828202 2016 A Conserved HIV-1-Derived Peptide Presented by HLA-E Renders Infected T-cells Highly Susceptible to Attack by NKG2A/CD94-Bearing Natural Killer Cells.
26613595 2015 An HLA-C amino-acid variant in addition to HLA-B*27 confers risk for ankylosing spondylitis in the Korean population.
26600554 2015 Association between HLA-C*04 and American cutaneous leishmaniasis in endemic region of southern Brazil.
26589762 2016 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency.
26542067 2016 Significant association of the KIR2DL3/HLA-C1 genotype with susceptibility to Crohn's disease.
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26470763 2016 HLA-C and TNF gene polymorphisms are associated with psoriasis in Brazilian patients.
26416275 2015 Regulation of Adaptive NK Cells and CD8 T Cells by HLA-C Correlates with Allogeneic Hematopoietic Cell Transplantation and with Cytomegalovirus Reactivation.
26383988 2015 The Relationship Between Killer Cell Immunoglobulin-Like Receptors and HLA-C Polymorphisms in Colorectal Cancer in a Saudi Population.
26372271 2015 The effect of KIR2D-HLA-C receptor-ligand interactions on clinical outcome in a HIV-1 CRF01_AE-infected Thai population.
26262501 2016 Deleterious Impact of Donor-Specific Anti-HLA Antibodies Toward HLA-Cw and HLA-DP in Kidney Transplantation.
26206121 2016 Genetic (KIR, HLA-C) and Some Clinical Parameters Influencing the Level of Liver Enzymes and Early Virologic Response in Patients with Chronic Hepatitis C.
26068923 2015 Protective Effect of HLA-B*5701 and HLA-C -35 Genetic Variants in HIV-Positive Caucasians from Northern Poland.
25972545 2015 Respiratory Syncytial Virus Infection Upregulates NLRC5 and Major Histocompatibility Complex Class I Expression through RIG-I Induction in Airway Epithelial Cells.
25960307 2015 Impact of KIR and HLA Genotypes on Outcomes after Reduced-Intensity Conditioning Hematopoietic Cell Transplantation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894195 2015 Human leukocyte antigen Cw7-mediated protection against polyoma BK virus in renal transplant recipients who received grafts from antigen-positive donors.
25844609 2015 Study of human leukocyte antigen-cw in Egyptian patients with vitiligo.
25794162 2015 The Cw6 and late-cornified envelope genotype plays a significant role in anti-tumor necrosis factor response among psoriatic patients.
25754738 2015 Relative expression levels of the HLA class-I proteins in normal and HIV-infected cells.
25715101 2015 The HLA-C*04: 01/KIR2DS4 gene combination and human leukocyte antigen alleles with high population frequency drive rate of HIV disease progression.
25714001 2015 HLA-allelotype associations with nevirapine-induced hypersensitivity reactions and hepatotoxicity: a systematic review of the literature and meta-analysis.
25666956 2015 DNA typing of HLA-A, -C, -B, AND -DRB1 in the children with autism in the Republic of Macedonia.
25633660 2015 Identification of HLA-C restricted, HIV-1-specific CTL epitopes by peptide induced upregulation of HLA-C expression.
25626601 2015 Polymorphisms of HLA-A, -B, -Cw and DRB1 antigens in Moroccan patients with ankylosing spondylitis and a comparison of clinical features with frequencies of HLA-B*27.
25581336 2015 Association of killer cell immunoglobulin-like receptor and human leucocyte antigen-Cw gene combinations with systemic lupus erythematosus.
25495410 2014 HLA-A*02:01:01/-B*35:01:01/-C*04:01:01 haplotype associated with lamotrigine-induced maculopapular exanthema in Mexican Mestizo patients.
25493653 2015 A single SNP surrogate for genotyping HLA-C*06:02 in diverse populations.
25454626 2014 Significance of association of HLA-C and HLA-E with psoriatic arthritis.
25367742 2014 Maternal HLA-C2 and 14?bp insertion in HLA-G is associated with recurrent implantation failure after in vitro fertilization treatment.
25329633 2014 Genetic risk for co-occurrence of type 1 diabetes and celiac disease is modified by HLA-C and killer immunoglobulin-like receptors.
25323824 2014 HLA-C expression levels define permissible mismatches in hematopoietic cell transplantation.
25278127 2015 Acute myeloid leukemia is a disease associated with HLA-C3.
25237729 2015 Homozygosity for HLA group 2 alleles predicts treatment failure with interferon-? and ribavirin in chronic hepatitis C virus genotype 1 infection.
25188020 2014 Implication of HLA-C and KIR alleles in human papillomavirus infection and associated cervical lesions.
25083782 2014 HLA-C -35kb expression SNP is associated with differential control of ?-HPV infection in squamous cell carcinoma cases and controls.
24990997 2014 The immunodominant influenza A virus M158-66 cytotoxic T lymphocyte epitope exhibits degenerate class I major histocompatibility complex restriction in humans.
24986480 2014 Lack of association between KIR and HLA-C type and susceptibility to idiopathic bronchiectasis.
24951171 2015 Association of maternal KIR and fetal HLA-C genes with the risk of preeclampsia in the Chinese Han population.
24911933 2014 Interaction of parental KIR and fetal HLA-C genotypes with the risk of preeclampsia.
24842861 2014 KIR and a specific HLA-C gene are associated with susceptibility and resistance to hepatitis B virus infection in a Brazilian population.
24818561 2014 Association of killer cell immunoglobulin-like receptor gene 2DL1 and its HLA-C2 ligand with family history of cancer in oral squamous cell carcinoma.
24791935 2014 Genotype-phenotype correlations in a prospective cohort study of paediatric plaque psoriasis: lack of correlation between HLA-C*06 and family history of psoriasis.
24785948 2014 Sequence variations in HIV-1 p24 Gag-derived epitopes can alter binding of KIR2DL2 to HLA-C*03:04 and modulate primary natural killer cell function.
24778445 2014 Maternal KIR in combination with paternal HLA-C2 regulate human birth weight.
24759677 2014 A single nucleotide polymorphism -35 kb T>C (rs9264942) is strongly associated with psoriasis vulgaris depending on HLA-Cw(?)06.
24755350 2014 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with epithelial ovarian cancer.
24717292 2014 Impact of donor mismatches at individual HLA-A, -B, -C, -DR, and -DQ loci on the development of HLA-specific antibodies in patients listed for repeat renal transplantation.
24651768 2014 Conjunctival scarring in trachoma is associated with the HLA-C ligand of KIR and is exacerbated by heterozygosity at KIR2DL2/KIR2DL3.
24566686 2014 Human leukocyte antigen (HLA)-C polymorphisms are associated with a decreased risk of rheumatoid arthritis.
24554773 2014 NK cell killer Ig-like receptor repertoire acquisition and maturation are strongly modulated by HLA class I molecules.
24408320 2014 Identification of a permissible HLA mismatch in hematopoietic stem cell transplantation.
24349500 2013 KIR, HLA, and IL28B variant predict response to antiviral therapy in genotype 1 chronic hepatitis C patients in Japan.
24324648 2013 Genome-wide association study for levels of total serum IgE identifies HLA-C in a Japanese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24248364 2013 Genetic interplay between HLA-C and MIR148A in HIV control and Crohn disease.
24227846 2014 Immunoprevalence and immunodominance of HLA-Cw*0801-restricted T cell response targeting the hepatitis B virus envelope transmembrane region.
24162738 2013 New loci associated with chronic hepatitis B virus infection in Han Chinese.
24046013 2013 High-resolution HLA matching in hematopoietic stem cell transplantation: a retrospective collaborative analysis.
24006284 2013 Quantified colocalization reveals heterotypic histocompatibility class I antigen associations on trophoblast cell membranes: relevance for human pregnancy.
23990973 2013 An in-depth characterization of the major psoriasis susceptibility locus identifies candidate susceptibility alleles within an HLA-C enhancer element.
23974321 2013 Killer cell immunoglobulin-like receptor (KIR) genes and their HLA-C ligands in a Ugandan population.
23935489 2013 Association study of common genetic variants and HIV-1 acquisition in 6,300 infected cases and 7,200 controls.
23901134 2013 HLA-C alleles confer risk for anti-citrullinated peptide antibody-positive rheumatoid arthritis independent of HLA-DRB1 alleles.
23853074 2014 A genome-wide association study identifies 6p21 as novel risk locus for dilated cardiomyopathy.
23838325 2013 The spatio-temporal expression of MHC class I molecules during human hippocampal formation development.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23588886 2013 Association analysis of the HLA-C gene in Japanese alopecia areata.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23559252 2013 Influence of HLA-C expression level on HIV control.
23536655 2013 Epstein-Barr virus negativity among individuals older than 60 years is associated with HLA-C and HLA-Bw4 variants and tonsillectomy.
23521149 2013 Pharmacogenetics of psoriasis: HLA-Cw6 but not LCE3B/3C deletion nor TNFAIP3 polymorphism predisposes to clinical response to interleukin 12/23 blocker ustekinumab.
23462218 2013 MHC-driven HIV-1 control on the long run is not systematically determined at early times post-HIV-1 infection.
23417110 2013 Genome-wide association study identified the human leukocyte antigen region as a novel locus for plasma beta-2 microglobulin.
23398510 2013 Association of KIR genes and HLA-C alleles with HPV-related uterine cervical disease in Korean women.
23390293 2013 HLA reduces killer cell Ig-like receptor expression level and frequency in a humanized mouse model.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362284 2013 Association of human leukocyte antigen alleles and nevirapine hypersensitivity in a Malawian HIV-infected population.
23330836 2013 Association of human leukocyte antigen class I antigens in Iranian patients with pemphigus vulgaris.
23246585 2013 Filling the gaps - the generation of full genomic sequences for 15 common and well-documented HLA class I alleles using next-generation sequencing technology.
23200758 2013 High-resolution HLA haplotype frequencies of stem cell donors in Germany with foreign parentage: how can they be used to improve unrelated donor searches?
23184486 2013 HLA-C, DRB1 and DQB1 alleles involved in genetic predisposition to psoriasis vulgaris in the Slovak population.
23177929 2013 Non-random mating, parent-of-origin, and maternal-fetal incompatibility effects in schizophrenia.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
23028341 2012 Genome-wide association study for serum complement C3 and C4 levels in healthy Chinese subjects.
22958291 2012 Human leukocyte antigen-C and killer cell immunoglobulin-like receptor gene polymorphisms among patients with syphilis in a Chinese Han population.
22931917 2013 Genetic association with ERAP1 in psoriasis is confined to disease onset after puberty and not dependent on HLA-C*06.
22931314 2012 HLA-C-dependent prevention of leukemia relapse by donor activating KIR2DS1.
22923333 2012 Molecular architecture of the MHC I peptide-loading complex: one tapasin molecule is essential and sufficient for antigen processing.
22803655 2012 Protective effect of HLA-DRB1 11 and predisposition of HLA-C 04 in the development of severe liver damage in Brazilian patients with chronic hepatitis C virus infection.
22772445 2012 Mutation at positively selected positions in the binding site for HLA-C shows that KIR2DL1 is a more refined but less adaptable NK cell receptor than KIR2DL3.
22586163 2012 Differential human leucocyte allele association between psoriasis and psoriatic arthritis: a family-based association study.
22569429 2012 HLA-C polymorphisms in two cohorts of donors for bone marrow transplantation.
22548719 2012 Characterization of the HLA-C*07:01:01G allele group in European and African-American cohorts.
22512642 2012 Paediatric-onset psoriasis is associated with ERAP1 and IL23R loci, LCE3C_LCE3B deletion and HLA-C*06.
22510299 Patients with psoriatic arthritis may show differences in their clinical and genetic profiles depending on their age at psoriasis onset.
22509813 2012 Association of killer cell immunoglobulin-like receptor and human leukocyte antigen-C genotype with dry eye disease in a Chinese Han population.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22474021 2012 High frequency of HIV mutations associated with HLA-C suggests enhanced HLA-C-restricted CTL selective pressure associated with an AIDS-protective polymorphism.
22321328 2011 [Association between HLA-Cw polymorphism and inflammatory bowel disease].
22319020 2012 A genome-wide association study for coronary artery disease identifies a novel susceptibility locus in the major histocompatibility complex.
22251067 2012 Allele-specific amplification of the complete HLA-C gene from genomic DNA - a novel Cw4 allele (C*04:71) with a Cw1 motif in the peptide-binding site.
22219647 2011 A study of KIR genes and HLA-C in Vogt-Koyanagi-Harada disease in Saudi Arabia.
22194166 2011 Association between HLA-Cw*0602 polymorphism and psoriasis risk: a meta-analysis.
22185807 2012 Killer immunoglobulin-like receptor locus polymorphisms in multiple sclerosis.
22125590 2011 Psoriasis regression analysis of MHC loci identifies shared genetic variants with vitiligo.
22113476 2012 Allele-specific cytokine responses at the HLA-C locus: implications for psoriasis.
22099809 2011 Impact of pretransplant human leukocyte antigen-C and -DP antibodies on kidney graft outcome.
22074999 2012 Human leukocyte antigen class I (A, B, C) and II (DRB1) diversity in the black and Caucasian South African population.
22069276 2011 Killer cell immunoglobulin-like receptor along with HLA-C ligand genes are associated with type 1 diabetes in Chinese Han population.
22035606 2012 Characterization of the novel HLA-C*16:07:02 allele in a family of Benin origin.
22031944 2012 Multiple viral ligands naturally presented by different class I molecules in transporter antigen processing-deficient vaccinia virus-infected cells.
21985130 2012 HLA polymorphism among Chinese patients with chronic plaque psoriasis: subgroup analysis.
21958371 2011 Human-leukocyte antigen class I Cw 1502 and class II DR 0301 genotypes are associated with resistance to severe acute respiratory syndrome (SARS) infection.
21931540 2011 IL28B, HLA-C, and KIR variants additively predict response to therapy in chronic hepatitis C virus infection in a European Cohort: a cross-sectional study.
21920398 2011 KIR genes and their human leukocyte antigen ligands in the progression to cirrhosis in patients with chronic hepatitis C.
21912600 2011 KIR and HLA-C interactions promote differential dendritic cell maturation and is a major determinant of graft failure following kidney transplantation.
21912425 2013 A whole-genome association study of major determinants for allopurinol-related Stevens-Johnson syndrome and toxic epidermal necrolysis in Japanese patients.
21909837 2011 An increased frequency of NK cell receptor and HLA-C group 1 combinations in early-onset type 1 diabetes.
21860345 2011 Rising HIV-1 viral load set point at a population level coincides with a fading impact of host genetic factors on HIV-1 control.
21797986 2011 KIR3DL1+HLA-B Bw4Ile80 and KIR2DS1+HLA-C2 combinations are both associated with ankylosing spondylitis in the Iranian population.
21738480 2011 Multiple loci are associated with white blood cell phenotypes.
21732917 2011 Characterization of 236 novel alleles at the HLA-A, -B, -C, -DRB1, -DQB1 and -DPB1 loci from China Marrow Donor Program.
21712058 2012 Common and well-documented (CWD) alleles of human leukocyte antigen-A, -B, -C, -DRB1, and -DQB1 loci for the Chinese Han population do not quite correlate with the ASHI CWD alleles.
21699788 2011 HLA-Cw*1202-B*5201-DRB1*1502 haplotype increases risk for ulcerative colitis but reduces risk for Crohn's disease.
21658009 2011 Characterization and polymorphic analysis of 4.5 kb genomic full-length HLA-C in the Chinese Han population.
21625020 2011 Associations between HLA-C alleles and definite Meniere's disease.
21585707 2011 Analysis for complete genomic sequence of HLA-B and HLA-C alleles in the Chinese Han population.
21412248 2011 HLA-C, CSTA and DS12346 susceptibility alleles confer over 100-fold increased risk of developing psoriasis: evidence of gene interaction.
21410657 2011 C*07:185, a novel HLA-C*07 allele identified by sequence-based typing.
21373785 2012 Killer immunoglobulin-like receptor and human leukocyte antigen-C genotypes in rheumatoid arthritis primary responders and non-responders to anti-TNF-? therapy.
21352198 2011 Association of CD8+ T cell infiltration in oesophageal carcinoma lesions with human leucocyte antigen (HLA) class I antigen expression and survival.
21248048 2011 Reappraisal of the relationship between the HIV-1-protective single-nucleotide polymorphism 35 kilobases upstream of the HLA-C gene and surface HLA-C expression.
21179506 2010 Matched sizes of activating and inhibitory receptor/ligand pairs are required for optimal signal integration by human natural killer cells.
21134695 2011 HLA-C C1C2 heterozygosity may protect women bearing the killer immunoglobulin-like receptor AA genotype from spontaneous abortion.
21107349 2011 Meta-analysis confirms the LCE3C_LCE3B deletion as a risk factor for psoriasis in several ethnic groups and finds interaction with HLA-Cw6.
21084992 2011 An additive effect of protective host genetic factors correlates with HIV nonprogression status.
21059899 2011 MHC variation and risk of childhood B-cell precursor acute lymphoblastic leukemia.
21051598 2010 The major genetic determinants of HIV-1 control affect HLA class I peptide presentation.
21049023 2010 A polymorphism in the HLA-DPB1 gene is associated with susceptibility to multiple sclerosis.
20974205 2011 Human leukocyte antigen-A, -B, -C, -DRB1 allele and haplotype frequencies in Americans originating from southern Europe: contrasting patterns of population differentiation between Italian and Spanish Americans.
20972337 2010 Maternal activating KIRs protect against human reproductive failure mediated by fetal HLA-C2.
20970669 2010 Association of HLA haplotypes with paroxysmal nocturnal hemoglobinuria.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20953188 2010 Genome-wide association study identifies a psoriasis susceptibility locus at TRAF3IP2.
20953186 2010 Common variants at TRAF3IP2 are associated with susceptibility to psoriatic arthritis and psoriasis.
20946353 2011 Receptor-mediated ER export of human MHC class I molecules is regulated by the C-terminal single amino acid.
20937338 2011 HLA-A, -B, -C, -DQB1, and -DRB1,3,4,5 allele and haplotype frequencies in the Costa Rica Central Valley Population and its relationship to worldwide populations.
20935224 2010 Genotypes of NK cell KIR receptors, their ligands, and Fc? receptors in the response of neuroblastoma patients to Hu14.18-IL2 immunotherapy.
20931685 2010 Human leukocyte antigen (HLA) and single nucleotide polymorphisms (SNPs) tumor necrosis factor (TNF)-alpha -238 and -308 as genetic markers of susceptibility to psoriasis and severity of the disease in a long-term follow-up Brazilian study.
20923372 2010 Class I HLA-A*7401 is associated with protection from HIV-1 acquisition and disease progression in Mbeya, Tanzania.
20857097 2010 HLA-Cw group 1 ligands for KIR increase susceptibility to invasive cervical cancer.
20798335 2010 HLA class I and genetic susceptibility to type 1 diabetes: results from the Type 1 Diabetes Genetics Consortium.
20739527 2010 HLA-Cw*03-restricted CD8+ T-cell responses targeting the HIV-1 gag major homology region drive virus immune escape and fitness constraints compensated for by intracodon variation.
20713950 2010 HLA B*44: protective effects in MS susceptibility and MRI outcome measures.
20684489 2010 Genetic aspect of venom allergy: association with HLA class I and class II antigens.
20678810 2010 Two HLA class I genes independently associated with multiple sclerosis.
20668555 2010 Extended LTA, TNF, LST1 and HLA gene haplotypes and their association with rubella vaccine-induced immunity.
20660184 2010 Additive contribution of HLA class I alleles in the immune control of HIV-1 infection.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20643584 2010 Inhibitory KIR and specific HLA-C gene combinations confer susceptibility to or protection against chronic hepatitis B.
20637045 2010 Genetic link among Hani, Bulang and other Southeast Asian populations: evidence from HLA -A, -B, -C, -DRB1 genes and haplotypes distribution.
20626025 2010 Celiac disease-associated antibodies in patients with psoriasis and correlation with HLA Cw6.
20613458 2010 Association between HLA inheritance and asthma medication use in HIV positive children.
20608062 2010 [Class 1 and 2 HLA in coeliacia patients in Belarus].
20604894 2010 Comparison of MHC class I risk haplotypes in Thai and Caucasian psoriatics shows locus heterogeneity at PSORS1.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20595243 2010 HLA genotyping in the international Type 1 Diabetes Genetics Consortium.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20580654 2010 Association of killer cell immunoglobulin-like receptors and human leukocyte antigen-C genotypes in South Brazilian with type 1 diabetes.
20574122 2010 Inhibitory killer cell immunoglobulin-like receptor KIR3DL1 in combination with HLA-B Bw4iso protect against ankylosing spondylitis.
20561448 2010 [Genetic polymorphism of Chinese Zhuang population at HLA-Cw locus by sequence based typing].
20559009 2010 HLA status in patients with chronic spontaneous urticaria.
20549830 2010 Correlation of molecular human leukocyte antigen typing and outcome in high-risk melanoma patients receiving adjuvant interferon.
20547040 2010 A single nucleotide polymorphism of MHC region is associated with subphenotypes of Psoriasis in Chinese population.
20536993 2010 HLA genotype in patients with acquired haemophilia A.
20526339 2010 Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.
20519398 2010 Influence of HLA class I and HLA-KIR compound genotypes on HIV-2 infection and markers of disease progression in a Manjako community in West Africa.
20512145 2010 A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.
20504258 2010 HLA-B*5901 is strongly associated with methazolamide-induced Stevens-Johnson syndrome/toxic epidermal necrolysis.
20492599 2010 Correlation between genetic HLA class I and II polymorphisms and anthropological aspects in the Chaouya population from Morocco (Arabic speaking).
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20492592 2010 The association and differentiation of MHC class I polymorphic Alu insertions and HLA-B/Cw alleles in seven Chinese populations.
20483367 2010 Role of killer cell immunoglobulin-like receptor gene content and human leukocyte antigen-C group in susceptibility to human T-lymphotropic virus 1-associated myelopathy/tropical spastic paraparesis in Peru.
20466636 2010 [Single nucleotide polymorphisms in 22 HLA-Cw alleles in Chinese Han population].
20463068 2010 Counteraction of HLA-C-mediated immune control of HIV-1 by Nef.
20462405 2010 HLA Class I and II profiles in São Miguel Island (Azores): genetic diversity and linkage disequilibrium.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20456039 2010 Natural killer cell receptor and HLA-C gene polymorphisms among patients with hepatitis C: a comparison between sustained virological responders and non-responders.
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20416195 2010 [Frequencies of high-resolution HLA-Cw* alleles in China Northern Han population].
20385791 2010 Human leukocyte antigen class I and II alleles in non-Hodgkin lymphoma etiology.
20356536 2010 [Killer cell immunoglobin-like receptor and its ligand gene polymorphisms in Hunan Han patients with type 1 diabetes].
20347497 2010 Genetic associations in Italian primary sclerosing cholangitis: heterogeneity across Europe defines a critical role for HLA-C.
20335219 2010 Impact of highly conserved HLA haplotype on acute graft-versus-host disease.
20334121 2009 Association of human leukocyte antigen and esophageal cancer in North of Iran.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20235791 2010 Common risk allele in aromatic antiepileptic-drug induced Stevens-Johnson syndrome and toxic epidermal necrolysis in Han Chinese.
20230525 2010 HLA class I and II alleles and haplotypes in ethnic Northeast Thais.
20224785 2010 Human leukocyte antigens and HIV type 1 viral load in early and chronic infection: predominance of evolving relationships.
20219611 2010 Allelic diversity and haplotype structure of HLA loci in the Chinese Han population living in the Guanzhong region of the Shaanxi province.
20210919 2010 HLA-DQA1*0505 sharing and killer immunoglobulin-like receptors in sub fertile couples: report from the 15th International Histocompatibility Workshop.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
20193031 2010 Compound KIR-HLA genotype analyses in the Iranian population by a novel PCR-SSP assay.
20173792 2010 The role of killer immunoglobulin-like receptor haplotypes on the outcome of unrelated donor haematopoietic SCT for thalassaemia.
20173784 2010 The beneficial impact of missing KIR ligands and absence of donor KIR2DS3 gene on outcome following unrelated hematopoietic SCT for myeloid leukemia in the Chinese population.
20169624 2010 Specific human leukocyte antigen class I and II alleles associated with hepatitis C virus viremia.
20145915 2010 HLA class I and class II HLA DRB profiles in Egyptian children with rheumatic valvular disease.
20137308 2009 [Relationship between CMV reactivation and KIR haplotype/HLA-Cw genotype in patients after unrelated-donor hematopoietic stem cell transplantation.].
20097244 2010 MICA polymorphism in a northern Chinese Han population: The identification of a new MICA allele, MICA*059.
20090103 2009 Association of HLA alleles with hepatitis C infection in Maharashtra, western India.
20082621 2010 Killer cell immunoglobulin-like receptor (KIR) genes in systemic sclerosis.
20082482 2010 Immunogenetic characteristics of patients with autoimmune gastritis.
20077564 2010 Consistent beneficial effects of killer cell immunoglobulin-like receptor 2DL3 and group 1 human leukocyte antigen-C following exposure to hepatitis C virus.
20073992 2010 Association between HLA-B*4001 and lipodystrophy among HIV-infected patients from Thailand who received a stavudine-containing antiretroviral regimen.
20056126 2010 B-lymphoma cells escape rituximab-triggered elimination by NK cells through increased HLA class I expression.
20041166 2009 Common genetic variation and the control of HIV-1 in humans.
20016497 2010 Replication of LCE3C-LCE3B CNV as a risk factor for psoriasis and analysis of interaction with other genetic risk factors.
20003137 2010 HLA alleles and haplotypes distribution in Dai population in Yunnan province, Southwest China.
19968064 2009 [Effects of killer immunoglobulin-like receptor and human leukocyte antigen class I ligand on the prognosis of related donor hematopoietic stem cell transplantation].
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19936734 2010 Distribution of killer cell immunoglobulin-like receptors (KIR) and their HLA-C ligands in two Iranian populations.
19935663 2009 HLA-C cell surface expression and control of HIV/AIDS correlate with a variant upstream of HLA-C.
19934297 2009 KIR and HLA genotypes are associated with disease progression and survival following autologous hematopoietic stem cell transplantation for high-risk neuroblastoma.
19932885 2010 Association of HLA class I alleles with keloids in Chinese Han individuals.
19931565 2010 Human leukocyte antigen alleles and the response to pegylated interferon/ribavirin therapy in chronic hepatitis C patients.
19925877 2010 Nonmyeloablative HLA-haploidentical bone marrow transplantation with high-dose posttransplantation cyclophosphamide: effect of HLA disparity on outcome.
19924143 2010 Diverging effects of HLA-DPB1 matching status on outcome following unrelated donor transplantation depending on disease stage and the degree of matching for other HLA alleles.
19912639 2009 HLA-E gene polymorphism associates with ankylosing spondylitis in Sardinia.
19907433 2010 HLA-class I markers and multiple sclerosis susceptibility in the Italian population.
19898503 2010 Effect of missing killer-immunoglobulin-like receptor ligand in recipients undergoing HLA full matched, non-T-depleted sibling donor transplantation: a single institution experience of 151 Asian patients.
19896518 2010 Effect of human leukocyte antigen homozygosity on rubella vaccine-induced humoral and cell-mediated immune responses.
19874367 2010 Simple and rapid screening for HLA-Cw*06 in Polish patients with psoriasis.
19861144 2010 Activating killer cell immunoglobulin-like receptors 3DS1 and 2DS1 protect against developing the severe form of recurrent respiratory papillomatosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19850842 2010 Killer cell immunoglobulin-like receptors in HLA-B27-associated acute anterior uveitis, with and without axial spondyloarthropathy.
19846535 2010 Effect of killer immunoglobulin-like receptors in the response to combined treatment in patients with chronic hepatitis C virus infection.
19845952 2009 HLA-Cw*04 allele associated with nevirapine-induced rash in HIV-infected Thai patients.
19845915 2009 Molecular variation at the HLA-A, B, C, DRB1, DQA1, and DQB1 loci in full heritage American Indians in Arizona: private haplotypes and their evolution.
19843037 2009 Regulatory allospecific NK cell function is differentially associated with HLA C allotypes.
19830740 2009 Soluble HLA-I-mediated secretion of TGF-beta1 by human NK cells and consequent down-regulation of anti-tumor cytolytic activity.
19789864 2009 Susceptibility to Crohn's disease is mediated by KIR2DL2/KIR2DL3 heterozygosity and the HLA-C ligand.
19776241 2010 HLA-C is necessary for optimal human immunodeficiency virus type 1 infection of human peripheral blood CD4 lymphocytes.
19774073 2009 Genetic epidemiology of glioblastoma multiforme: confirmatory and new findings from analyses of human leukocyte antigen alleles and motifs.
19762282 2009 Behavior of non-classical soluble HLA class G antigens in human immunodeficiency virus 1-infected patients before and after HAART: comparison with classical soluble HLA-A, -B, -C antigens and potential role in immune-reconstitution.
19758198 2009 Race differences in immunogenetic features and photosensitivity of cutaneous lupus erythematosus from the aspect of Japanese studies.
19744147 2009 Thirty-six novel HLA alleles: 7 HLA-A, 11 HLA-B, 15 HLA-C and 3 HLA-DRB1.
19728333 2010 The prognostic role of classical and nonclassical MHC class I expression in endometrial cancer.
19703234 2009 HLA allele and haplotype frequencies in the Albanian population and their relationship with the other European populations.
19694795 2010 HLA class I markers in Japanese patients with carbamazepine-induced cutaneous adverse reactions.
19693088 2009 The HLA-B/-C haplotype block contains major determinants for host control of HIV.
19683555 2009 Role of human leukocyte antigen, killer-cell immunoglobulin-like receptors, and cytokine gene polymorphisms in leptospirosis.
19680446 2009 Multiple Loci within the major histocompatibility complex confer risk of psoriasis.
19668019 2009 High-resolution HLA genotyping and severe cutaneous adverse reactions in lamotrigine-treated patients.
19667963 2009 HLA-C matching and liver transplants: donor-recipient genotypes influence early outcome and CD8+KIR2D+ T-cells recuperation.
19663932 2009 Immunogenetic susceptibility to diabetes mellitus in patients with liver disease.
19663693 2009 Impact of select immunologic and virologic biomarkers on CD4 cell count decrease in patients with chronic HIV-1 subtype C infection: results from Sinikithemba Cohort, Durban, South Africa.
19656140 2009 HLA-C and liver transplant outcomes: interpreting the facts.
19654877 2009 Association between protective and deleterious HLA alleles with multiple sclerosis in Central East Sardinia.
19654407 2009 Donor-recipient mismatches in MHC class I chain-related gene A in unrelated donor transplantation lead to increased incidence of acute graft-versus-host disease.
19653987 2009 HLA class I and II polymorphisms in Mexican Mestizo patients with dengue fever.
19631389 2009 Fetal-maternal HLA-C mismatch is associated with decidual T cell activation and induction of functional T regulatory cells.
19630074 2009 Killer immunoglobulin-like receptor ligand HLA-Bw4 protects against multiple sclerosis.
19620980 2009 Genetic variants at 6p21.33 are associated with susceptibility to follicular lymphoma.
19589487 2009 HLA-A disparities illustrate challenges for ranking the impact of HLA mismatches on bone marrow transplant outcomes in the United States.
19574026 2009 Extensive genetic polymorphism in the haplotype STR-TNF and HLA class I with the onset and evolution of psoriasis vulgaris.
19571811 2009 Common polygenic variation contributes to risk of schizophrenia and bipolar disorder.
19552960 2009 Protective KIR-HLA interactions for HCV infection in intravenous drug users.
19549379 2009 [Gene KIR in match with HLA-Cw impacts on NK cell cytotoxicity].
19544559 2009 Synergistic effect of HLA class II loci and cytokine gene polymorphisms on the risk of gastric cancer in Japanese patients with Helicobacter pylori infection.
19539218 2009 Effects of mismatching for minor histocompatibility antigens on clinical outcomes in HLA-matched, unrelated hematopoietic stem cell transplants.
19525279 2009 Characterisation of psoriasis susceptibility locus 6 (PSORS6) in patients with early onset psoriasis and evidence for interaction with PSORS1.
19493233 2009 Distribution of HLA-A, -B, -Cw, and -DRB1 alleles and haplotypes in an isolated Han population in Southwest China.
19493232 2009 Killer immunoglobulin-like receptors (KIR2DL2 and/or KIR2DS2) in presence of their ligand (HLA-C1 group) protect against chronic myeloid leukaemia.
19487887 2009 Human leukocyte antigen frequency in human high-grade gliomas: a case-control study in Sicily.
19480851 2009 High-resolution human leukocyte antigen (HLA) haplotypes and linkage disequilibrium of HLA-B and -C and HLA-DRB1 and -DQB1 alleles in a Taiwanese population.
19480679 2009 HLA-Cw*0602 associates with a twofold higher prevalence of positive streptococcal throat swab at the onset of psoriasis: a case control study.
19409091 2009 Ethnic and geographical differences in HLA associations with the outcome of hepatitis C virus infection.
19407364 2009 HLA haplotype A33-B58-Cw10 may modulate radiographic development of bamboo spine in Taiwanese patients with primary ankylosing spondylitis.
19392983 2009 Reassessing the impact of donor HLA-C genotype on long-term liver transplant survival.
19364514 2009 HLA polymorphism in six Malay subethnic groups in Malaysia.
19350523 2009 [Analysis on haplotypes of five HLA loci in southern Chinese Han population by sequence-based typing].
19349081 2009 HLA class I and II alleles and response to treatment with interferon-beta in relapsing-remitting multiple sclerosis.
19326408 2009 Killer cell immunoglobulin-like receptor genotype and killer cell immunoglobulin-like receptor-human leukocyte antigen C ligand compatibility affect the severity of hepatitis C virus recurrence after liver transplantation.
19299434 2009 Is neuromyelitis optica associated with human leukocyte antigen?
19276793 2009 Host genetics and HIV-1 viral load set-point in African-Americans.
19262574 2009 Genome-wide association scan yields new insights into the immunopathogenesis of psoriasis.
19246116 2009 Analysis of HLA class I and II alleles regarding to lymph node and distant metastasis in patients with non-small cell lung cancer.
19242058 2009 Associations between HLA-C alleles and papillary thyroid carcinoma.
19232441 2009 Gene-environment interactions between HLA B7/A2, EBV antibodies are associated with MRI injury in multiple sclerosis.
19227412 HLA types in Turkish children with celiac disease.
19214504 2009 The common Scandinavian human leucocyte antigen ancestral haplotype 62.1 as prognostic factor in patients with advanced malignant melanoma.
19200845 2009 Influence of host genetic variation on rubella-specific T cell cytokine responses following rubella vaccination.
19200828 2009 HLA haplotype and supertype associations with cellular immune responses and cytokine production in healthy children after rubella vaccine.
19196481 2009 High resolution human leukocyte antigen (HLA) class I and class II allele typing in Mexican mestizo women with sporadic breast cancer: case-control study.
19184033 2009 HLA-Cw*06 class I region rather than MICA is associated with psoriatic arthritis in Czech population.
19181658 2009 Association of killer cell immunoglobulin-like receptors with primary Sjogren's syndrome.
19180512 2009 HLA-E gene polymorphism associated with susceptibility to Kawasaki disease and formation of coronary artery aneurysms.
19169284 2009 KIR genes and KIR ligands affect occurrence of acute GVHD after unrelated, 12/12 HLA matched, hematopoietic stem cell transplantation.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
19169253 2009 Deletion of the late cornified envelope LCE3B and LCE3C genes as a susceptibility factor for psoriasis.
19159415 2009 High-resolution HLA matching in double-umbilical-cord-blood reduced-intensity transplantation in adults.
19143818 2009 Analysis of maternal-offspring HLA compatibility, parent-of-origin and non-inherited maternal effects for the classical HLA loci in type 1 diabetes.
19143812 2009 The frequent and conserved DR3-B8-A1 extended haplotype confers less diabetes risk than other DR3 haplotypes.
19120281 2008 Different KIRs confer susceptibility and protection to adults with latent autoimmune diabetes in Latvian and Asian Indian populations.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
19104471 2009 HLA-B*3505 allele is a strong predictor for nevirapine-induced skin adverse drug reactions in HIV-infected Thai patients.
19096254 2008 [Clinical outcomes of lamivudine therapy and HLA alleles in chronic hepatitis B patients].
19054371 2008 Polymorphic insertions in 5 Alu loci within the major histocompatibility complex class I region and their linkage disequilibria with HLA alleles in four distinct populations in mainland China.
19050382 2009 Association of HLA-C and HCP5 gene regions with the clinical course of HIV-1 infection.
19046302 2008 Combination of KIR 2DL2 and HLA-C1 (Asn 80) confers susceptibility to type 1 diabetes in Latvians.
19032228 2008 Natural killer cell receptor repertoire and their ligands, and the risk of CMV infection after kidney transplantation.
19023492 HLA class I and II and TNF-alpha gene polymorphisms in sarcoidosis patients.
19019964 2009 HLA-associated clinical progression correlates with epitope reversion rates in early human immunodeficiency virus infection.
19000140 2009 HLA-A, -B, -C, and -DRB1 allele and haplotype frequencies distinguish Eastern European Americans from the general European American population.
18997170 2009 HLA mismatch combinations associated with decreased risk of relapse: implications for the molecular mechanism.
18987736 2008 DNA sequencing of a cytogenetically normal acute myeloid leukaemia genome.
18987136 2009 Identification of major histocompatibility complex class I C molecule as an attachment factor that facilitates coronavirus HKU1 spike-mediated infection.
18982067 2008 HIV-1 disease-influencing effects associated with ZNRD1, HCP5 and HLA-C alleles are attributable mainly to either HLA-A10 or HLA-B*57 alleles.
18976440 2008 The clinical implications of HLA mismatches in unrelated donor haematopoietic cell transplantation.
18976432 2008 HLA-A, B, Cw, DRB1, DQB1 and DPB1 alleles and haplotypes in the genetically homogenous Irish population.
18958335 2008 Inhibitor-Immunology-Study. Different HLA-types seem to be involved in the inhibitor development in haemophilia A.
18922348 2008 Evaluation of HLA-A, -B, -Cw, and -DRB1 alleles frequency in Turkish patients with nasal polyposis.
18852273 2009 Polymorphism in the human major histocompatibility complex and early viral decline during treatment of chronic hepatitis C.
18848853 2008 Killer cell immunoglobulin-like receptor gene diversity in a Southern Brazilian population from the state of Paraná.
18800148 2009 Genetic variants of the IL-23R pathway: association with psoriatic arthritis and psoriasis vulgaris, but no specific risk factor for arthritis.
18782112 2008 Soluble HLA-G and HLA-A,-B,-C serum levels in patients with allergic rhinitis.
18778326 2008 Association between killer-cell immunoglobulin-like receptor genotypes and leprosy in Brazil.
18768435 2008 Matched unrelated or matched sibling donors result in comparable survival after allogeneic stem-cell transplantation in elderly patients with acute myeloid leukemia: a report from the cooperative German Transplant Study Group.
18702622 2009 Combined effects of HLA-Cw6 and cigarette smoking in psoriasis vulgaris: a hospital-based case-control study in China.
18684953 2008 Human leukocyte antigen class I genotypes in relation to heterosexual HIV type 1 transmission within discordant couples.
18673537 2008 HLA-C increases HIV-1 infectivity and is associated with gp120.
18671674 2008 Donor HLA-C genotype has a profound impact on the clinical outcome following liver transplantation.
18643961 2008 A study of the killer cell immunoglobulin-like receptor gene KIR2DS1 in a Caucasoid Brazilian population with psoriasis vulgaris.
18627572 2008 New insights of HLA class I association to Behçet's disease in Portuguese patients.
18596105 2008 Central role of reverting mutations in HLA associations with human immunodeficiency virus set point.
18585007 2008 Combined effects of HLA-Cw6, body mass index and waist-hip ratio on psoriasis vulgaris in Chinese Han population.
18580606 2008 Human leukocyte antigen-specific polymorphisms in HIV-1 Gag and their association with viral load in chronic untreated infection.
18571006 2008 KIR and HLA gene combinations in Vogt-Koyanagi-Harada disease.
18566368 2008 Killer Ig-like receptor expression in uterine NK cells is biased toward recognition of HLA-C and alters with gestational age.
18544086 2008 Impact of HLA-DPB1 allelic and single amino acid mismatches on HSCT.
18543232 2008 [Analysis of HLA-Cw, KIR2D genetic variations in 2 Chinese populations].
18523244 2008 A novel trafficking signal within the HLA-C cytoplasmic tail allows regulated expression upon differentiation of macrophages.
18521626 2009 HLA class I alleles in HTLV-1-associated myelopathy and asymptomatic carriers from the Brazilian cohort GIPH.
18515573 2008 Age-related macular degeneration is associated with the HLA-Cw*0701 Genotype and the natural killer cell receptor AA haplotype.
18496418 2008 Immunogenetic correlates of Neisseria gonorrhoeae infection in adolescents.
18486765 Type 1 diabetes risk for human leukocyte antigen (HLA)-DR3 haplotypes depends on genotypic context: association of DPB1 and HLA class I loci among DR3- and DR4-matched Italian patients and controls.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18451182 2008 Comprehensive analysis of HLA-A, HLA-B, HLA-C, HLA-DRB1, and HLA-DQB1 loci and squamous cell cervical cancer risk.
18434400 2008 HLA class I-driven evolution of human immunodeficiency virus type 1 subtype c proteome: immune escape and viral load.
18420581 2008 N-linked glycosylation selectively regulates the generic folding of HLA-Cw1.
18396213 2008 Paroxysmal nocturnal hemoglobinuria: significant association with specific HLA-A, -B, -C, and -DR alleles in an Italian population.
18385790 2008 HLA class I and II gene polymorphisms in Stevens-Johnson syndrome with ocular complications in Japanese.
18381784 2008 Human leukocyte antigen and clinical and demographic characteristics in psoriatic arthritis and psoriasis in Chinese patients.
18369459 2008 A genome-wide association study of psoriasis and psoriatic arthritis identifies new disease loci.
18369457 2008 Fine mapping of the psoriasis susceptibility locus PSORS1 supports HLA-C as the susceptibility gene in the Han Chinese population.
18364739 2008 Association analysis of the skin barrier gene cystatin A at the PSORS5 locus in psoriatic patients: evidence for interaction between PSORS1 and PSORS5.
18364390 2008 Identification of ZNF313/RNF114 as a novel psoriasis susceptibility gene.
18347914 2008 The diversity of KIR gene in Chinese Northern Han population and the impact of donor KIR and patient HLA genotypes on outcome following HLA-identical sibling allogeneic hematopoietic stem cell transplantation for hematological malignancy in Chinese people.
18340360 2008 Combination of KIR and HLA gene variants augments the risk of developing birdshot chorioretinopathy in HLA-A*29-positive individuals.
18332066 2008 HLA-DQ3 is a probable risk factor for CMV infection in high-risk kidney transplant patients.
18329312 2008 Distribution of HLA-B*27 subtypes in Tunisians and their association with ankylosing spondylitis.
18315912 2008 [Impact of donor KIR2DS5 genotype on outcome following haploidentical hematopoietic stem cell transplantation].
18309376 Several regions in the major histocompatibility complex confer risk for anti-CCP-antibody positive rheumatoid arthritis, independent of the DRB1 locus.
18301962 2008 Association of HLA alleles with non-Hodgkin's lymphoma in Korean population.
18297378 2008 Polymorphisms of KIRs gene and HLA-C alleles in patients with ankylosing spondylitis: possible association with susceptibility to the disease.
18289678 2008 Interaction of NK inhibitory receptor genes with HLA-C and MHC class II alleles in Hepatitis C virus infection outcome.
18263639 2008 Association of maternal killer-cell immunoglobulin-like receptors and parental HLA-C genotypes with recurrent miscarriage.
18219280 2008 Polymorphisms of the IL12B and IL23R genes are associated with psoriasis.
18186800 2008 Distribution of KIR genes in the Czech population.
18091530 2007 KIR/HLA ligand incompatibility in kidney transplantation.
18086268 2008 Identification of the very uncommon allele HLA-Cw*0716 in a Caucasian renal transplant recipient: extension of the exon 4 sequence.
18086267 2008 HLA-A, -B, -C, -DRB1 and -DQB1 alleles and haplotypes in the Kinh population in Vietnam.
18082573 2007 HLA class I polymorphism in the Cuban population.
18075513 2008 Variants in the 5q31 cytokine gene cluster are associated with psoriasis.
18074415 2007 Hla-Cw7 allele as predictor of favorable therapeutic response to interferon-alpha in patients with chronic hepatitis C.
18070207 2008 Genotyping of HLA-I and HLA-II alleles in Chinese patients with paraneoplastic pemphigus.
18069932 2008 Identification of the novel HLA-C allele Cw*0751.
18064508 2008 Polymorphisms of human leukocyte antigen genes in korean children with Kawasaki disease.
18005090 2008 The new HLA-C allele, Cw*0220, shows a new polymorphism at amino acid position 169.
17997746 2007 Association of killer cell immunoglobulin-like receptor genotypes with susceptibility to endometriosis.
17990989 2007 Killer cell immunoglobulin-like receptor genotypes in Japanese patients with type 1 diabetes.
17971053 2008 Description of two new HLA-C alleles in a black South African population.
17971052 2008 Haplotype-specific pattern of association of human major histocompatibility complex with non-Hodgkin's lymphoma outcome.
17964196 Immunogenetic factors in donors and patients that affect the outcome of hematopoietic stem cell transplantation.
17956696 2007 [Haplotype and linkage analysis of HLA-I classical genes in Chinese Han population].
17950922 2007 Status of donor-recipient HLA class I ligands and not the KIR genotype is predictive for the outcome of unrelated hematopoietic stem cell transplantation in beta-thalassemia patients.
17939409 2007 [Preliminary study of the effect of HLA-Cw on haploidentical hematopoietic stem cell transplantation].
17927716 2007 Genetic contribution of major histocompatibility complex class II region to type 1 autoimmune hepatitis susceptibility in Venezuela.
17911430 2007 Genetic control of immune response in carriers of the 8.1 ancestral haplotype: correlation with levels of IgG subclasses: its relevance in the pathogenesis of autoimmune diseases.
17909631 2007 HLA class I polymorphisms are associated with development of infectious mononucleosis upon primary EBV infection.
17900288 2007 HLA class I (A, B, C) and class II (DRB1, DQA1, DQB1, DPB1) alleles and haplotypes in the Han from southern China.
17878941 2007 ADAM33, a new candidate for psoriasis susceptibility.
17869653 2007 High-resolution HLA alleles and haplotypes in the United States population.
17868255 2007 No association of KIR genes with Behcet's disease.
17785583 2007 High-resolution donor-recipient HLA matching contributes to the success of unrelated donor marrow transplantation.
17728335 2008 Investigating the role of the HLA-Cw*06 and HLA-DRB1 genes in susceptibility to psoriatic arthritis: comparison with psoriasis and undifferentiated inflammatory arthritis.
17726164 2007 The importance of HLA-DPB1 in unrelated donor hematopoietic cell transplantation.
17714418 2007 The alloimmune response to the human platelet antigen-1a is not related to maternal-fetal killer immunoglobulinlike receptor/HLA-Cw combinations.
17666781 2007 Lack of association of HLA-C alleles with late-onset psoriasis in the northern Polish population.
17661908 2007 Analysis of HLA class I-II haplotype frequency and segregation in a cohort of patients with advanced stage ovarian cancer.
17652849 2007 Association between HLA-DRB1*01 and HLA-Cw*08 and outcome following HTLV-I infection.
17641165 2007 A whole-genome association study of major determinants for host control of HIV-1.
17617375 2007 Increased activating killer immunoglobulin-like receptor genes and decreased specific HLA-C alleles in couples with recurrent spontaneous abortion.
17604825 2007 Human leukocyte antigens in undifferentiated spondyloarthritis.
17598037 2007 Comparison of clinical features of HLA-Cw*0602-positive and -negative psoriasis patients in a Han Chinese population.
17597093 2007 A novel and major association of HLA-C in Graves' disease that eclipses the classical HLA-DRB1 effect.
17578051 2007 Human leukocyte antigen (HLA) class I and II alleles in Turkish patients with rheumatic heart disease.
17573956 2007 Association between hepatic alveolar echinococcosis and frequency of human leukocyte antigen class I and II alleles in Turkish patients.
17554059 2007 High-risk HLA allele mismatch combinations responsible for severe acute graft-versus-host disease and implication for its molecular mechanism.
17530646 2007 TNF polymorphisms in psoriasis: association of psoriatic arthritis with the promoter polymorphism TNF*-857 independent of the PSORS1 risk allele.
17523949 2007 Association of HLA genes with ankylosing spondylitis in Han population of eastern China.
17509453 2007 HLA-A, -B, -C, and -DRB1 allele frequencies in Cuban individuals with antecedents of dengue 2 disease: advantages of the Cuban population for HLA studies of dengue virus infection.
17504510 2007 Molecular diversity of HLA-A, -B and -C alleles in a North Indian population as determined by PCR-SSOP.
17498269 2007 HLA alleles as predisposal factors for postmenopausal osteoporosis in a Greek population.
17491685 2005 The role of HLA class I gene variation in autoimmune diabetes.
17489060 2007 Chronic hepatitis C infection and sicca syndrome: a clear association with HLA DQB1*02.
17480220 2007 Associations between HLA class I alleles and the prevalence of nasopharyngeal carcinoma (NPC) among Tunisians.
17471440 2007 Effects of human leukocyte antigen class I genetic parameters on clinical outcomes and survival after initiation of highly active antiretroviral therapy.
17462512 2007 HLA class I polymorphism in Mongolian and Hui ethnic groups from Northern China.
17462511 2007 HLA haplotypes in Singapore: a study of mothers and their cord blood units.
17407088 2007 [ssociation of HLA class I and II alleles with generalized vitiligo in Chinese Hans in north China].
17392574 2006 Relationship between human leucocyte antigen class I and class II and chronic idiopathic urticaria associated with aspirin and/or NSAIDs hypersensitivity.
17389029 2007 Sequence-based typing characterization of the novel HLA-Cw*1609 allele in the Moroccan Chaouya group.
17388919 2007 Cytokine gene polymorphisms in Chinese patients with psoriasis.
17383044 2007 Particular genetic variants of ligands for natural killer cell receptors may contribute to the HLA associated risk of primary sclerosing cholangitis.
17378697 2007 MHC haplotype matching for unrelated hematopoietic cell transplantation.
17373939 2007 Polymorphism of HLA class I genes in Meizhou Han population of Guangdong, China.
17340018 2007 Clinical associations of the risk alleles of HLA-Cw6 and CCHCR1*WWCC in psoriasis.
17317585 2007 Effects of HLA allele and killer immunoglobulin-like receptor ligand matching on clinical outcome in leukemia patients undergoing transplantation with T-cell-replete marrow from an unrelated donor.
17311253 2007 Association of human leukocyte antigen ancestral haplotype 8.1 with adverse outcome of non-Hodgkin's lymphoma.
17309450 2007 Psoriasis vulgaris and human leukocyte antigens.
17258541 2007 Strong association between HLA-A*0206 and Stevens-Johnson syndrome in the Japanese.
17252545 2007 A second major histocompatibility complex susceptibility locus for multiple sclerosis.
17234427 2006 Human leukocyte antigen and interleukin 2, 10 and 12p40 cytokine responses to measles: is there evidence of the HLA effect?
17223660 2007 HLA-Cw6 and HLA-DRB1*07 together are associated with less severe joint disease in psoriatic arthritis.
17212710 2007 HLA-A, -B, -C, -DRB1 allele and haplotype frequencies in an African American population.
17207712 2007 Impact of recipient HLA-C in liver transplant: a protective effect of HLA-Cw*07 on acute rejection.
17197830 2007 HLA-Cw8 primarily associated with hypersensitivity to nevirapine.
17166285 2006 HLA-C locus alleles may modulate the clinical expression of psoriatic arthritis.
17117954 2006 Allelic distribution of HLA class I genes in the Tibetan ethnic population of China.
17106278 2007 Human leukocyte antigen class I and class II allele frequencies and HIV-1 infection associations in a Chinese cohort.
17101473 Association of HLA-A, -B, -C genes and TNF microsatellite polymorphism with psoriasis vulgaris: a study of genetic risk in Brazilian patients.
17092264 2006 A new HLA-Cw*03 variant - Cw*031102.
17085834 2006 HLA alleles in pre-menopausal breast cancer patients from western India.
17082605 2006 Segregation of HLA-C from ICAM-1 at NK cell immune synapses is controlled by its cell surface density.
17062033 2006 Association of HLA haplotype with alopecia areata in Chinese Hans.
17029201 2006 [Genetic polymorphism of HLA-Cw locus in hematopoietic stem cell transplantation patient and donor population].
17026471 2006 Characterization of HLA-B*5516, -B*1313, -B*9512, and -DRB1*1457 alleles identified in a southwest Chinese population.
17021767 2006 Association of HLA loci alleles and antigens in Saudi patients with vitiligo.
16947780 2006 Association of HLA-C3 and smoking with vasculitis in patients with rheumatoid arthritis.
16929347 2006 Killer Ig-like receptor (KIR) genotype and HLA ligand combinations in ulcerative colitis susceptibility.
16922942 2006 MHC haplotypic association in Chinese Han patients with vitiligo.
16890179 2006 Alteration of the influences of HLA classes I and II alleles on the perinatal hepatitis B virus infection after immunoprophylaxis in Korean children.
16866883 2006 High-resolution molecular characterization of the HLA class I and class II in the Tarahumara Amerindian population.
16857416 2007 HLA and MICA associations with head and neck squamous cell carcinoma.
16829306 2006 A role for KIR gene variants other than KIR2DS1 in conferring susceptibility to psoriasis.
16788244 2006 Non classical HLA genes and non-HLA genes in a population of infants at familial risk of atopy.
16774550 2006 A new HLA-CW*14 allele, Cw*140204, identified by allele-specific DNA amplification and sequencing.
16720218 Identification of two novel HLA-C alleles, Cw*070105 and Cw*1408, from East African women.
16720212 Association of an extended haplotype of HLA class I alleles and their flanking microsatellites with spondyloarthropathies in South Indian patients.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16642438 2006 Sequence and haplotype analysis supports HLA-C as the psoriasis susceptibility 1 gene.
16634885 2006 HLA Cw*06 is not essential for streptococcal-induced psoriasis.
16609350 2006 Immunogenetic risk and protective factors for the idiopathic inflammatory myopathies: distinct HLA-A, -B, -Cw, -DRB1, and -DQA1 allelic profiles distinguish European American patients with different myositis autoantibodies.
16571411 2005 HLA-C and KIR genes in hepatitis C virus infection.
16532100 2006 Association of HLA class I and class II alleles with psoriasis vulgaris in Turkish population. Influence of type I and II psoriasis.
16532020 2006 HLA-C mismatch is associated with inferior survival after unrelated donor non-myeloablative hematopoietic stem cell transplantation.
16490887 2006 Associations of HLA-C alleles with multinodular goiters: study in a population from southeastern Spain.
16489264 2005 HLA allele associations and V-beta T-lymphocyte expansions in patients with psoriasis, harboring toxin-producing Staphylococcus aureus.
16459714 2006 Intrathecal synthesis of soluble HLA-G and HLA-I molecules are reciprocally associated to clinical and MRI activity in patients with multiple sclerosis.
16455884 2006 Epidemiological and genetic correlates of severe acute respiratory syndrome coronavirus infection in the hospital with the highest nosocomial infection rate in Taiwan in 2003.
16451198 2006 HLA class I diversity among rural rainforest inhabitants in Cameroon: identification of A*2612-B*4407 haplotype.
16441500 2006 Identification of two novel HLA-C alleles, HLA-Cw*1217 and HLA-Cw*030404, in Singapore Chinese.
16439971 2006 Distinct clinical differences between HLA-Cw*0602 positive and negative psoriasis patients--an analysis of 1019 HLA-C- and HLA-B-typed patients.
16405603 2006 Correlation between HLA and pityriasis rosea susceptibility in Brazilian blacks.
16365741 2006 HLA class I and class II frequencies in patients with cutaneous malignant melanoma from southeastern Spain: the role of HLA-C in disease prognosis.
16339849 2006 Evidence for susceptibility determinant(s) to psoriasis vulgaris in or near PTPN22 in German patients.
16331567 2005 [High resolution DNA typing for HLA-A, B, Cw genes by polymerase chain reaction-sequence specific oligonucleotide probes method in the Shenyang Han population].
16331510 2005 Immunologic significance of HLA class I genes in measles virus-specific IFN-gamma and IL-4 cytokine immune responses.
16313304 2005 HLA-C locus alleles distribution in patients from northern Poland with psoriatic arthritis--preliminary report.
16297191 2005 The region of 150 kb telometic to HLA-C is associated with psoriasis in the Jewish population.
16284396 2005 Variation of the killer cell immunoglobulin-like receptors and HLA-C genes in nasopharyngeal carcinoma.
16281939 2005 Homozygosity for human leucocyte antigen-C ligands of KIR2DL1 is associated with increased risk of relapse after human leucocyte antigen-C-matched unrelated donor haematopoietic stem cell transplantation.
16272320 2005 Impaired assembly results in the accumulation of multiple HLA-C heavy chain folding intermediates.
16267409 2005 Immunogenetic risk and protective factors for the idiopathic inflammatory myopathies: distinct HLA-A, -B, -Cw, -DRB1 and -DQA1 allelic profiles and motifs define clinicopathologic groups in caucasians.
16235096 2005 Localization of PSORS1 to a haplotype block harboring HLA-C and distinct from corneodesmosin and HCR.
16216678 2005 MICA polymorphism in a population from north Morocco, Metalsa Berbers, using sequence-based typing.
16215732 2005 High-throughput DNA typing of HLA-A, -B, -C, and -DRB1 loci by a PCR-SSOP-Luminex method in the Japanese population.
16185849 2006 Association of HLA class I alleles with aloplecia areata in Chinese Hans.
16185325 2005 Distributions of HLA class I alleles and haplotypes in Northern Han Chinese.
16185272 2005 Distinct HLA-C/KIR genotype profile associates with guttate psoriasis.
16129034 2005 [Association of gene HLA-class I with leukemia].
16103458 2005 Positive and negative associations of human leukocyte antigen variants with the onset and prognosis of adult glioblastoma multiforme.
16101836 2005 Novel HLA-Cw*01 allele, Cw*010203, identified by sequence-based typing*.
16097034 2005 Global phosphoproteome analysis on human HepG2 hepatocytes using reversed-phase diagonal LC.
16086295 2005 [HLA class I and II polymorphism and haplotypes in Guangdong Han population].
16029431 2005 MHC microsatellite diversity and linkage disequilibrium among common HLA-A, HLA-B, DRB1 haplotypes: implications for unrelated donor hematopoietic transplantation and disease association studies.
16029332 2005 A study of PSORS1C1 gene polymorphisms in Chinese patients with psoriasis.
16026588 2005 Molecular diversity of HLA-Cw alleles in the Maratha community of Mumbai, Maharashtra, western India.
16019679 Analysis of HLA class I and class II gene polymorphisms in Japanese patients with human T-cell lymphotropic virus type 1-associated uveitis.
15982262 2005 A newly identified HLA-C allele: Cw*1210, and confirmation of HLA-Cw*080102.
15982258 2005 Four new HLA class I alleles in Cauacasoids.
15953084 2005 Corneodesmosin (CDSN) gene association with psoriasis vulgaris in Caucasian but not in Japanese populations.
15943912 2005 Study of alanine-73 and aspartate-9 of HLA-C locus in Saudi psoriasis patients, using sequence-specific primers (PCR-SSP).
15940053 2005 IL-10 promoter gene polymorphism associated with the occurrence of chronic GVHD and its clinical course during systemic immunosuppressive treatment for chronic GVHD after allogeneic peripheral blood stem cell transplantation.
15896209 2005 A novel HLA-Cw*16 allele, Cw*160102, identified by cloning and sequencing.
15896208 2005 Characterization of a novel HLA-Cw*02 variant, Cw*0208, in a Caucasian individual.
15854032 2005 Fine mapping of the psoriasis susceptibility gene PSORS1: a reassessment of risk associated with a putative risk haplotype lacking HLA-Cw6.
15853898 2005 Allelic and haplotypic diversity of HLA-A, -B, -C, -DRB1, and -DQB1 genes in the Korean population.
15848982 2005 HLA-Cw*0602 associates more strongly to psoriasis in the Swedish population than variants of the novel 6p21.3 gene PSORS1C3.
15807454 2005 [Immunogenetic HLA markers of chronic viral hepatitis].
15751651 2004 [The study on HLA-Cw polymorphism from Xi'an Han population by PCR-sequence specific oligonucleotide probe].
15743917 2005 HLA-B*5801 allele as a genetic marker for severe cutaneous adverse reactions caused by allopurinol.
15737195 2005 Single-point haplotype scores telomeric to human leukocyte antigen-C give a high susceptibility major histocompatibility complex haplotype for psoriasis in a Caucasian population.
15683420 2005 Human leukocyte antigen allele associations in type-1 autoimmune hepatitis patients from western India.
15662734 2004 [Studies of the relationship of HLA polymorphisms and the infection of H. pylori in the population of Linqu in Shandong Province].
15654960 2005 The major psoriasis susceptibility locus PSORS1 is not a risk factor for late-onset psoriasis.
15654959 2005 Haplotype sharing analysis identifies a retroviral dUTPase as candidate susceptibility gene for psoriasis.
15650879 2005 HLA polymorphisms are associated with Helicobacter pylori infected gastric cancer in a high risk population, China.
15639927 2003 [The study of HLA-Cw polymorphism in Uygur population].
15603879 2004 The contribution of HLA class I antigens in immune status following two doses of rubella vaccination.
15554365 2004 [The distribution of HLA alleles class I and class II among patientes with psoriatic arthritis in Croatia].
15546341 2004 HLA class-I and class-II allele frequencies and two-locus haplotypes in Melanesians of Vanuatu and New Caledonia.
15539411 2005 Lack of genetic association of the three more common polymorphisms of CARD15 with psoriatic arthritis and psoriasis in a German cohort.
15535834 2004 Analysis of HLA DR, HLA DQ, C4A, FcgammaRIIa, FcgammaRIIIa, MBL, and IL-1Ra allelic variants in Caucasian systemic lupus erythematosus patients suggests an effect of the combined FcgammaRIIa R/R and IL-1Ra 2/2 genotypes on disease susceptibility.
15534563 2004 HIV and human leukocyte antigen association--the Indian scenario.
15523160 2004 Correlation of HLA-Cw*06 allele frequency with some clinical features of psoriasis vulgaris in the population of northern Poland.
15496201 2004 Molecular analysis of HLA allele frequencies and haplotypes in Baloch of Iran compared with related populations of Pakistan.
15480178 2004 Impact of HLA-A,B,C allele mismatches on outcome after unrelated blood stem cell transplantation in whites.
15361135 2004 HLA class-I and HLA class-II phenotypic, gene and haplotypic frequencies in Tunisians by using molecular typing data.
15323271 HLA alleles and lung cancer in a Turkish population.
15321756 2004 [HLA-Cw alleles polymorphism and haplotypes in Guangdong Han population].
15310528 2004 Gene for the activating natural killer cell receptor, KIR2DS1, is associated with susceptibility to psoriasis vulgaris.
15307871 2004 HLA disparity determines disease activity through pregnancy in women with inflammatory bowel disease.
15304010 2004 Molecular typing of human leukocyte antigen and related polymorphisms following whole genome amplification.
15301865 2004 Persistence of hepatitis C virus in a white population: associations with human leukocyte antigen class 1.
15300630 2004 [Microsatellite instability and loss of heterozygosity of human leucocyte antigen class I gene in cervical carcinoma].
15297676 2004 HLA and NK cell inhibitory receptor genes in resolving hepatitis C virus infection.
15251317 2004 Major histocompatibility complex class I and II antigens frequencies in Baloch ethnic group living in the southeast region of Iran.
15245541 2004 Haplotype associations of the MHC with psoriasis vulgaris in Chinese Hans.
15245377 2004 Polymorphism of HLA class I genes in the Brazilian population from the Northeastern State of Pernambuco corroborates anthropological evidence of its origin.
15245373 2004 Human leukocyte antigen-A, -B and -C alleles and human leukocyte antigen haplotypes in Turkey: relationship to other populations.
15239092 2004 Distinct MHC class I and II alleles are associated with hepatitis C viral clearance, originating from a single source.
15220037 2004 Transmission of HIV-1 and HLA-B allele-sharing within serodiscordant heterosexual Zambian couples.
15214895 2004 Genetic polymorphisms of the HCR gene and a genomic segment in close proximity to HLA-C are associated with patients with psoriasis in Taiwan.
15211110 2004 Human leukocyte antigens as genetic markers in Greek patients with sporadic pancreatic cancer.
15191952 2004 Impact of HLA class I and class II high-resolution matching on outcomes of unrelated donor bone marrow transplantation: HLA-C mismatching is associated with a strong adverse effect on transplantation outcome.
15191523 2004 HLA-B and HLA-C alleles and haplotypes in the Dravidian tribal populations of southern India.
15191522 2004 A psoriasis vulgaris protective gene maps close to the HLA-C locus on the EH18.2-extended haplotype.
15140038 2004 HLA-A*24020102L in the UK blood donor population.
15140030 2004 Major histocompatibility complex class I chain-related gene A in Thai psoriasis patients: MICA association as a part of human leukocyte antigen-B-Cw haplotypes.
15128924 2004 Association of maternal histocompatibility at class II HLA loci with maternal microchimerism in the fetus.
15124939 2004 HLA-DRB1* alleles and temporomandibular joint erosion in patients with various rheumatic diseases.
15122136 2004 Screening for arthrofibrosis after anterior cruciate ligament reconstruction: analysis of association with human leukocyte antigen.
15086350 2004 The MICA-A4 triplet repeats polymorphism in the transmembrane region confers additional risk for development of psoriatic arthritis in the Croatian population.
15072129 2004 HLA associations in leprosy patients from Mumbai, India.
15061705 2004 HLA typing in Taiwanese patients with oral submucous fibrosis.
15057902 2004 HLA and cytokine gene polymorphisms are independently associated with responses to hepatitis B vaccination.
15009808 2004 Association of polymorphic MHC microsatellites with GVHD, survival, and leukemia relapse in unrelated hematopoietic stem cell transplant donor/recipient pairs matched at five HLA loci.
15009803 2004 Differentiation between African populations is evidenced by the diversity of alleles and haplotypes of HLA class I loci.
14727382 2003 [Association of HLA class I and leukemia in mestizo patients of the state of Zulia, Venezuela].
14719207 2003 Clinical and genetic aspects of psoriatic arthritis "sine psoriasis".
14716759 2004 Frequency of HLA-C alleles in differentiated thyroid carcinoma in southeastern Spain.
14705987 2004 Human leukocyte antigen-A, -B, and -Cw polymorphism in a Berber population from North Morocco using sequence-based typing.
14705982 2004 The phylogenies of introns 4-7 demonstrate an inconsistent pattern between human leukocyte antigen-C group topologies.
14700599 2004 HLA alleles and haplotypes among the Lakota Sioux: report of the ASHI minority workshops, part III.
14675183 2003 HCR, a candidate gene for psoriasis, is expressed differently in psoriasis and other hyperproliferative skin disorders and is downregulated by interferon-gamma in keratinocytes.
14674935 2004 Lack of association of HLA class I genes and TNF alpha-308 polymorphism in toluene diisocyanate-induced asthma.
14626512 2003 Distribution of the HLA class I allele in chronic hepatitis C and its association with serum ALT level in chronic hepatitis C.
14617049 2003 HLA-C sequence based typing: nucleotide analysis from exon 1 through exon 8. Identification of a new allele: Cw*0718.
14617038 2003 HLA diversity among Nadars, a primitive Dravidian caste of South India.
14595379 2003 The cationic region from HIV tat enhances the cell-surface expression of epitope/MHC class I complexes.
14581545 2003 Comprehensive analysis of class I and class II HLA antigens and chronic hepatitis B virus infection.
14551034 HLA-A, B, C, DRB1, DQB1 matching heterogeneity in 'favourably matched' kidney recipients.
14527733 2003 Association of HLA class I alleles with psoriasis vulgaris in southeastern Chinese Hans.
14501803 2003 Association of HLA B*3520, B*1801, and Cw*1507 with HIV-1 infection Maharashtra, India.
14501786 2003 Prospective analysis of HLA classes I and II antigen frequency in patients with Peyronie's disease.
12975536 2003 Novel HLA Class I Alleles Associated with Indian Leprosy Patients.
12962836 2003 Impact of HLA-C on acute rejection in liver transplantation.
12956875 2003 Corneodesmosin gene: no evidence for PSORS 1 gene in North-eastern Thai psoriasis patients.
12941076 2003 Are there HLA combinations typical supporting for or making resistant against aggressive and/or chronic periodontitis?
12899833 2003 Sequence variability analysis of human class I and class II MHC molecules: functional and structural correlates of amino acid polymorphisms.
12870022 2003 [Genotyping of HLA-Cw locus in Chinese Yi ethnic group by PCR-SSP].
12857887 2003 Placental extravillous cytotrophoblasts persistently express class I major histocompatibility complex molecules after human cytomegalovirus infection.
12853576 2003 Human inhibitory receptors Ig-like transcript 2 (ILT2) and ILT4 compete with CD8 for MHC class I binding and bind preferentially to HLA-G.
12825172 2003 Human leukocyte antigen class I and II alleles and response to interferon-alpha treatment, in Taiwanese patients with chronic hepatitis C virus infection.
12794140 2003 Spontaneous clustering and tyrosine phosphorylation of NK cell inhibitory receptor induced by ligand binding.
12776912 2003 Distribution of HLA-C alleles determined by PCR-SSP in the population of Lower Silesia.
12774051 2003 The degree of matching at HLA-DPB1 predicts for acute graft-versus-host disease and disease relapse following haematopoietic stem cell transplantation.
12753667 2003 Genetic affinities among Mongol ethnic groups and their relationship to Turks.
12730526 2003 Psoriasis vulgaris and psoriatic arthritis share a 100 kb susceptibility region telomeric to HLA-C.
12709815 2003 Confirmation of PSORS psoriasis susceptibility loci in a Chinese population.
12665835 2003 Common genomic HLA haplotypes contributing to successful donor search in unrelated hematopoietic transplantation.
12651075 2003 Evidence for novel DRB1*15 allele association among clinically definite multiple sclerosis patients from Mumbai, India.
12648281 2003 Immunogenetics of the rare HLA-B allele B*4408.
12622774 2003 Cloning and sequencing full-length HLA-B and -C genes.
12619017 2003 Human leukocyte antigen-C in short- and long-term liver graft acceptance.
12594841 2003 Soluble HLA-A,-B,-C and -G molecules induce apoptosis in T and NK CD8+ cells and inhibit cytotoxic T cell activity through CD8 ligation.
12590984 2003 Distribution of MICA alleles and haplotypes associated with HLA in the Korean population.
12588373 2003 Psoriasis patients who are homozygous for the HLA-Cw*0602 allele have a 2.5-fold increased risk of developing psoriasis compared with Cw6 heterozygotes.
12574360 2003 Associations of MHC ancestral haplotypes with resistance/susceptibility to AIDS disease development.
12574356 2003 Locus-specific constitutive and cytokine-induced HLA class I gene expression.
12505198 2003 Strong association of HLA-Cw6 allele with juvenile psoriasis in Polish patients.
12492817 2002 Characterization of a novel HLA-C allele, Cw*0315.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12472658 2002 Psoriasis is associated with a SNP haplotype of the corneodesmosin gene (CDSN).
12472657 2002 HLA polymorphism in a Majorcan population of Jewish descent: comparison with Majorca, Minorca, Ibiza (Balearic Islands) and other Jewish communities.
12454284 2002 Disulfide bond-mediated dimerization of HLA-G on the cell surface.
12445319 2002 HLA polymorphism in six ethnic groups from Pakistan.
12445315 2002 The association of specific HLA class I and II alleles with type 1 diabetes among Filipinos.
12392856 2002 Association of HLA class I and class II alleles with susceptibility to endometriosis.
12372094 2002 Association of class I HLA antigens with the clinical manifestations of Turkish patients with Behçet's disease.
12352262 Associations between MHC class I and susceptibility to HIV-2 disease progression.
12296785 2002 HLA-A, B, Cw, DRB1, DRB3/4/5, DQB1 in German patients suffering from rapidly progressive periodontitis (RPP) and adult periodontitis (AP).
12195346 2002 Comprehensive analysis of human leukocyte antigen class I alleles and cervical neoplasia in 3 epidemiologic studies.
12148091 2002 Family-based analysis using a dense single-nucleotide polymorphism-based map defines genetic variation at PSORS1, the major psoriasis-susceptibility locus.
12115024 2002 HLA-Cw6 specificity and polymorphic residues are associated with susceptibility among Chinese psoriatics in Taiwan.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
12100686 2002 Haplotype associations of the major histocompatibility complex with psoriasis in Northeastern Thais.
12072195 2002 Molecular diversity of the HLA-C gene identified in a caucasian population.
12039411 2002 Molecular characterization of the HLA-Cw*0409N allele.
12028535 2002 Elongation of the cytoplasmic domain, due to a point deletion at exon 7, results in an HLA-C null allele, Cw*0409 N.
12022360 2002 MICA rather than MICB, TNFA, or HLA-DRB1 is associated with susceptibility to psoriatic arthritis.
12011375 2002 Tumour necrosis factor-alpha polymorphism and the HLA-Cw*0602 allele in psoriatic arthritis.
12010826 2002 The clinical significance of human leukocyte antigen (HLA) allele compatibility in patients receiving a marrow transplant from serologically HLA-A, HLA-B, and HLA-DR matched unrelated donors.
11984513 2002 HLA DRB10405-DQB10401 haplotype is associated with autoimmune pancreatitis in the Japanese population.
11972880 2002 Sequence of two new HLA-Cw alleles: HLA-Cw*0313 and HLA-Cw*1208.
11972879 2002 Two new HLA class I alleles recognised by PCR sequence-specific primer and sequencing based typing: B*3805 and Cw*0408.
11967296 2002 HLA-Cw*04 and hepatitis C virus persistence.
11927505 2002 Human leukocyte antigen class I alleles and cervical neoplasia: no heterozygote advantage.
11904677 2002 Distinctive KIR and HLA diversity in a panel of north Indian Hindus.
11888582 2002 Association between presence of HLA-B*5701, HLA-DR7, and HLA-DQ3 and hypersensitivity to HIV-1 reverse-transcriptase inhibitor abacavir.
11875053 2002 Coding haplotype analysis supports HCR as the putative susceptibility gene for psoriasis at the MHC PSORS1 locus.
11861287 2002 Soluble HLA class I molecules induce natural killer cell apoptosis through the engagement of CD8: evidence for a negative regulation exerted by members of the inhibitory receptor superfamily.
11841366 2002 Genotyping for HLA-A, B and C alleles in Japanese patients with pemphigus: prevalence of Asian alleles of the HLA-B15 family.
11751963 2002 Native HIV-1 Tat protein targets monocyte-derived dendritic cells and enhances their maturation, function, and antigen-specific T cell responses.
11696223 2001 Nucleotide sequence of exons 2 and 3 of the novel HLA-Cw*12032 allele.
11574100 2001 Polymorphic markers in MHC class II/III region: a study on Italian patients with myasthenia gravis.
11543903 2001 Analysis of the frequencies of HLA-A, B, and C alleles and haplotypes in the five major ethnic groups of the United States reveals high levels of diversity in these loci and contrasting distribution patterns in these populations.
11543893 2001 HLA polymorphism in the Murcia population (Spain): in the cradle of the archaeologic Iberians.
11543892 2001 Molecular analysis of HLA allelic frequencies and haplotypes in Jordanians and comparison with other related populations.
11390610 2001 Free major histocompatibility complex class I heavy chain is preferentially targeted for degradation by human T-cell leukemia/lymphotropic virus type 1 p12(I) protein.
11390039 2001 Sequence-based typing of HLA class I alleles in Alaskan Yupik Eskimo.
11390038 2001 Polymorphism in MICA rather than HLA-B/C genes is associated with psoriatic arthritis in the Jewish population.
11348465 2001 The HCR gene on 6p21 is unlikely to be a psoriasis susceptibility gene.
11323700 2001 Crystal structure of the human natural killer cell inhibitory receptor KIR2DL1-HLA-Cw4 complex.
11222331 2001 Immunogenetics and clinical phenotype of sympathetic ophthalmia in British and Irish patients.
11182228 2001 HLA class I diversity in Kolla Amerindians.
11181188 2001 [Two loci HLA haplotypes in celiac children. Linkage imbalance and haplotype frequencies. Comparative study with a control population].
11169245 2000 MICA 5.1 allele is a susceptibility marker for psoriasis in the Korean population.
11169242 2000 Allele frequencies and haplotypic associations defined by allelic DNA typing at HLA class I and class II loci in the Japanese population.
11169240 2000 HLA class I and class II allele distribution in the Peruvian population.
11163076 2000 N-linked carbohydrate on human leukocyte antigen-C and recognition by natural killer cell inhibitory receptors.
11144289 2000 HLA class I polymorphism, as characterised by PCR-SSOP, in a Brazilian exogamic population.
11122018 2000 HLA-C and guttate psoriasis.
11120862 2000 The influence of HLA class I alleles and heterozygosity on the outcome of human T cell lymphotropic virus type I infection.
11064107 2000 Serological HLA class I alleles in Senegalese blood donors detected HBs Ag positive.
11061291 2000 A new HLA-Cw allele (Cw*0808) found in a Colombian Mestizo individual possibly generated by an intralocus/interloci gene conversion.
11053636 2000 HLA-C(*)03 is a risk factor for cardiomyopathy in Chagas disease.
11009104 2000 A disulfide-linked natural killer cell receptor dimer has higher affinity for HLA-C than wild-type monomer.
10954160 2000 HLA-A, HLA-B and HLA-C polymorphism in the Slovak population.
10912513 2000 HLA-Cw*1404: a new HLA-C allele with a hybrid 77Asn-80Asn NK motif.
10898498 2000 HLA-E is expressed on trophoblast and interacts with CD94/NKG2 receptors on decidual NK cells.
10885573 2000 Identification of a novel HLA-Cw*05 allele, Cw*0503.
10850706 2000 Crystal structure of an NK cell immunoglobulin-like receptor in complex with its class I MHC ligand.
10820396 2000 Definition of polymorphic residues on killer Ig-like receptor proteins which contribute to the HLA-C binding site.
10809759 2000 Classical and nonclassical class I major histocompatibility complex molecules exhibit subtle conformational differences that affect binding to CD8alphaalpha.
10715516 2000 Differential expression of human major histocompatibility class I loci: HLA-A, -B, and -C.
10703619 2000 Identification of a novel HLA-Cw*07 variant (Cw*0714) in a German Caucasian family.
10647885 1999 A genome-wide search for genes predisposing to familial psoriasis by using a stratification approach.
10497191 1999 Killer cell immunoglobulin receptors and T cell receptors bind peptide-major histocompatibility complex class I with distinct thermodynamic and kinetic properties.
10488744 1999 There is more to HLA-C than exons 2 and 3: sequencing exons 1, 4 and 5.
10429675 1999 Structure of human histocompatibility leukocyte antigen (HLA)-Cw4, a ligand for the KIR2D natural killer cell inhibitory receptor.
10395115 1999 Characterization of a novel HLA-Cw*04 variant in a Laotian family: HLA-Cw*0406.
10395103 1999 Diversity of HLA-B17 alleles and haplotypes in East Asians and a novel Cw6 allele (Cw*0604) associated with B*5701.
10372547 1999 Correction of HLA-Cw*0501 and identification of HLA-Cw*0711.
10323347 1999 A new HLA-Cw*15 allele, Cw*1508, identified in the Peruvian population.
10190900 1999 A human histocompatibility leukocyte antigen (HLA)-G-specific receptor expressed on all natural killer cells.
10090622 1999 Identification of a novel HLA-C allele, Cw*0406, in a Singapore Malay.
9894860 1998 Identification of an HLA-C variant allele, Cw*0805, by sequencing based typing.
9894855 1998 A reliable and efficient high resolution typing method for HLA-C using sequence-based typing.
9840288 1998 On the role of the second coding exon of the HIV-1 Tat protein in virus replication and MHC class I downregulation.
9768753 1998 Kinetics of interaction of HLA-C ligands with natural killer cell inhibitory receptors.
9754572 1998 HLA-E-bound peptides influence recognition by inhibitory and triggering CD94/NKG2 receptors: preferential response to an HLA-G-derived nonamer.
9751712 1998 HIV-1 tat binds TAFII250 and represses TAFII250-dependent transcription of major histocompatibility class I genes.
9686604 1998 Sequence-based typing provides a new look at HLA-C diversity.
9686591 1998 Zinc bound to the killer cell-inhibitory receptor modulates the negative signal in human NK cells.
9672159 1998 Cw*0103, a new allele encoding for a novel HLA-Cw1 split in the Japanese population.
9601942 1998 A new apparently functional IGVK gene (VkLa) present in some individuals only.
9551969 1998 Reduced cell surface expression of HLA-C molecules correlates with restricted peptide binding and stable TAP interaction.
9464792 1997 Role of amino acid position 70 in the binding affinity of p50.1 and p58.1 receptors for HLA-Cw4 molecules.
9459510 1998 A new pair of HLA-C alleles, Cw*12042 and Cw*1203, differing at the KIR-related dimorphism of codons 77-80.
9459506 1998 Sequence of four new HLA-Cw alleles: a possible role of interallelic recombination.
9455497 HLA-B alleles associated with the B15 serologically defined antigens.
9435339 1998 A major histocompatibility complex class I allele shared by two species of chimpanzee.
9378975 1997 Molecular basis of HLA-C recognition by p58 natural killer cell inhibitory receptors.
9373155 1997 Identification of dynein heavy chain genes expressed in human and mouse testis: chromosomal localization of an axonemal dynein gene.
9293775 1997 Human uterine NK cells have a similar repertoire of killer inhibitory and activatory receptors to those found in blood, as demonstrated by RT-PCR and sequencing.
9234488 1997 The novel HLA-Cw*1802 allele is associated with B*5703 in the Bubi population from Equatorial Guinea.
9234483 1997 Molecular characterization of HLA-C incompatibilities in HLA-ABDR-matched unrelated bone marrow donor-recipient pairs. Sequence of two new Cw alleles (Cw*02023 and Cw*0707) and recognition by cytotoxic T lymphocytes.
9211742 1997 Cw*1701 defines a divergent african HLA-C allelic lineage.
9190911 1997 The TCR-delta repertoire in human intestine undergoes characteristic changes during fetal to adult development.
9177776 1997 Nucleotide sequence analysis of the HLA class I region spanning the 237-kb segment around the HLA-B and -C genes.
9158158 1997 Identification of a major susceptibility locus on chromosome 6p and evidence for further disease loci revealed by a two stage genome-wide search in psoriasis.
9153759 1997 Sequencing analysis of a 36.8 kb fragment of yeast chromosome XV reveals 26 open reading frames including SEC63, CDC31, SUG2, GCD1, RBL2, PNT1, PAC1 and VPH1.
9104816 1997 The human immunodeficiency virus type 1 (HIV-1) Vpu protein interferes with an early step in the biosynthesis of major histocompatibility complex (MHC) class I molecules.
9098935 1997 The complete primary structure of Cw*1701 reveals a highly divergent HLA class I molecule.
9089103 1997 Differences in intron 2 sequences between B*39061 and B*39062 in Amerindians: comparison with those of B*3901, B*5101, and B*52012 alleles.
9008313 1996 Molecular cloning of two new HLA-C alleles: Cw*1801 and Cw*0706.
8883300 1996 HLA-C typing of eleven Papua New Guineans: identification of an HLA-Cw4/Cw2 hybrid allele.
8805302 1996 Point mutations in the alpha 2 domain of HLA-A2.1 define a functionally relevant interaction with TAP.
8795149 1996 DNA typing of Cw*14 alleles in Japanese and the corrected sequence of Cw*1402.
8773323 1996 Haplotypic association of two new HLA class I alleles: Cw*15052 and B*0706: evolutionary relationships of HLA-Cw*15 alleles.
8769474 1996 Roles for calreticulin and a novel glycoprotein, tapasin, in the interaction of MHC class I molecules with TAP.
8692965 1996 Direct binding of a soluble natural killer cell inhibitory receptor to a soluble human leukocyte antigen-Cw4 class I major histocompatibility complex molecule.
8655361 1996 Identification and DNA typing of two Cw7 alleles (Cw*0702 and Cw*0704) in Japanese, with the corrected sequence of Cw*0702.
8617941 1996 Allele-specific differences in the interaction of MHC class I molecules with transporters associated with antigen processing.
8613148 1996 Correction of the HLA-Cw3 genomic sequence tentatively identifies it as HLA-Cw*0304.
8493575 1993 Repression of MHC class I gene promoter activity by two-exon Tat of HIV.
8225443 1994 A novel HLA-C allele (Cw*1504) related to the Cw6.2 phenotype.
8082899 1994 Cw*1505: a novel HLA-C allele isolated from a B*7301 haplotype.
7983384 1994 Targeted amplification of alternatively spliced transcripts of major histocompatibility complex class I heavy chain.
7957306 1994 Biogenesis of MHC class I antigens: involvement of multiple chaperone molecules.
7905471 1993 Molecular cloning and polymerase chain reaction-sequence-specific oligonucleotide detection of the allele encoding the novel allospecificity HLA-Cw6.2 (Cw*1502) in Spanish gypsies.
7897214 1995 The NKB1 and HP-3E4 NK cells receptors are structurally distinct glycoproteins and independently recognize polymorphic HLA-B and HLA-C molecules.
7871529 1994 HLA class I alleles of LCL 721 and 174 x CEM.T2 (T2).
7860363 1994 Molecular characterization of a novel, serologically detectable, HLA-C allele: Cw*1602.
7839353 1994 Identification of two new HLA-C alleles, Cw*1203 and Cw*1402, from the sequence analysis of seven HLA homozygous cell lines carrying HLA-C blank.
7760000 1995 Low HLA-C expression at cell surfaces correlates with increased turnover of heavy chain mRNA.
7650491 1995 Existence of both inhibitory (p58) and activatory (p50) receptors for HLA-C molecules in human natural killer cells.
7621073 1995 HIV Tat represses transcription through Sp1-like elements in the basal promoter.
7499177 1995 A new HLA-C allele, Cw*1403, associated with HLA-B44 in Japanese.
7482492 1995 Anchored PCR cloning of the novel HLA-Cw*0704 allele detected by PCR-SSP.
6609813 1984 Complete nucleotide sequence of a gene encoding a functional human class I histocompatibility antigen (HLA-CW3).
6591601 1984 The detailed distribution of HLA-A, B, C antigens in normal human organs.
6585830 1984 Orientation of loci within the human major histocompatibility complex by chromosomal in situ hybridization.
3863816 1985 Comparison of HLA class I gene sequences. Derivation of locus-specific oligonucleotide probes specific for HLA-A, HLA-B, and HLA-C genes.
3485286 1986 Complete sequence of HLA-B27 cDNA identified through the characterization of structural markers unique to the HLA-A, -B, and -C allelic series.
3032784 1987 Isolation, expression, and the primary structure of HLA-Cw1 and HLA-Cw2 genes: evolutionary aspects.
2843461 1988 Cloning and analysis of HLA class I cDNA encoding a new HLA-C specificity Cx52.
2787363 1989 The structure and expression of genes encoding serologically undetected HLA-C locus antigens.
2715640 1989 Diversity and diversification of HLA-A,B,C alleles.
2714853 1989 Isolation and expression of a cDNA clone encoding HLA-Cw6: unique characteristics of HLA-C encoded gene products.
2708822 1989 Complete nucleotide sequence of a unique HLA class I C locus product expressed on the human choriocarcinoma cell line BeWo.
2450918 1988 Specific associations of fluorescent beta-2-microglobulin with cell surfaces. The affinity of different H-2 and HLA antigens for beta-2-microglobulin.
2000377 1991 Isolation and characterization of yeast artificial chromosome clones linking the HLA-B and HLA-C loci.
1711567 1991 Human immunodeficiency virus type 1 gp120 mimics a hidden monomorphic epitope borne by class I major histocompatibility complex heavy chains.
1598685 1992 Isolation and characterization of a genomic HLA-Cw6 clone.
1384166 1992 The molecular basis for reactivity of anti-Cw1 and anti-Cw3 alloantisera with HLA-B46 haplotypes.
1383381 1992 Distinctive polymorphism at the HLA-C locus: implications for the expression of HLA-C.
1317015 1992 Unusual HLA-B alleles in two tribes of Brazilian Indians.
1055432 1975 Evolutionary relationship between immunoglobulins and transplantation antigens.