Property Summary

NCBI Gene PubMed Count 755
PubMed Score 777.37
PubTator Score 146.73

Knowledge Summary

Patent

No data available

Synonym

Accession P30504 O78067 O78072 O78090 O78149 Q29921 Q9UM42
Symbols MHC
HLAC
HLC-C
D6S204
PSORS1
HLA-JY3

Gene

PDB

1IM9   1QQD  

Gene RIF (831)

PMID Text
26828202 HLA-C expressed on HIV-infected cells restricts attack by KIR2DL(+) CD56(dim) natural killer (NK) cells
26613595 four amino-acid positions of HLA-B and -C account for most of the associations between ankylosing spondylitis and MHC in the Korean population
26600554 Therefore, the results obtained in this study demonstrate the involvement of HLA class I genes in the susceptibility or resistance to American cutaneous leishmaniasis (ACL), with significant association between HLA-C*04 and ACL susceptibility.
26589762 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency
26542067 gene polymorphism is associated with Crohn's disease in Spanish patients
26472014 genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians
26470763 HLA-C genetic polymorphism is associated with psoriasis.
26416275 Data suggest regulatory interactions between major histocompatibility antigen HLA-C and killer cell Ig-like receptor (KIR) might promote Graft-versus-Leukemia effects following transplantation.
26383988 HLA-C2 and -C1, showed highly significant associations with CRC development.
26372271 The authors have identified a deleterious effect of the KIR2DL3-HLA-C1 receptor-ligand combination on HIV clinical outcomes in a Thai cohort.
More...

AA Sequence

MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE      1 - 70
PREPWVEQEGPEYWDRETQKYKRQAQADRVNLRKLRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQF     71 - 140
AYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPK    141 - 210
THVTHHPVSDHEATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGGKGGSCSQAAS    281 - 350
SNSAQGSDESLIACKA                                                          351 - 366
//

Text Mined References (757)

PMID Year Title
26828202 2016 A Conserved HIV-1-Derived Peptide Presented by HLA-E Renders Infected T-cells Highly Susceptible to Attack by NKG2A/CD94-Bearing Natural Killer Cells.
26613595 2015 An HLA-C amino-acid variant in addition to HLA-B*27 confers risk for ankylosing spondylitis in the Korean population.
26600554 2015 Association between HLA-C*04 and American cutaneous leishmaniasis in endemic region of southern Brazil.
26589762 2016 Recurrent Pregnancy Loss in Women with Killer Cell Immunoglobulin-Like Receptor KIR2DS1 is Associated with an Increased HLA-C2 Allelic Frequency.
26542067 2016 Significant association of the KIR2DL3/HLA-C1 genotype with susceptibility to Crohn's disease.
26472014 2016 Genetic associations of killer immunoglobulin like receptors and class I human leukocyte antigens on childhood acute lymphoblastic leukemia among north Indians.
26470763 2016 HLA-C and TNF gene polymorphisms are associated with psoriasis in Brazilian patients.
26416275 2015 Regulation of Adaptive NK Cells and CD8 T Cells by HLA-C Correlates with Allogeneic Hematopoietic Cell Transplantation and with Cytomegalovirus Reactivation.
26383988 2015 The Relationship Between Killer Cell Immunoglobulin-Like Receptors and HLA-C Polymorphisms in Colorectal Cancer in a Saudi Population.
26372271 2015 The effect of KIR2D-HLA-C receptor-ligand interactions on clinical outcome in a HIV-1 CRF01_AE-infected Thai population.
More...