Property Summary

NCBI Gene PubMed Count 784
PubMed Score 830.51
PubTator Score 146.73

Knowledge Summary

Patent

No data available

Gene RIF (814)

AA Sequence

MRVMEPRTLILLLSGALALTETWACSHSMRYFYTAVSRPSRGEPHFIAVGYVDDTQFVRFDSDAASPRGE      1 - 70
PRGRWVEQEGPEYWDRETQKYNRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYDQS     71 - 140
AYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEEWRAYLEGECVEWLRRYLENGKEKLQRAEHPK    141 - 210
THVTHHPVSDHEATLRCWALGFYPTEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIVAGLAVLAVLAVLGAVVAVVMCRRKSSGGKGGSCSQAAS    281 - 350
SNSAQGSDESLIASKA                                                          351 - 366
//

Text Mined References (787)

PMID Year Title