Property Summary

NCBI Gene PubMed Count 1,697
PubMed Score 1568.81
PubTator Score 6027.77

Knowledge Summary

Patent

No data available

Synonym

Accession P30498 O62915 Q29924 Q546M4
Symbols AS
HLAB
B-4901

Gene

 GO Function (1)

Gene RIF (1702)

PMID Text
26967484 HLA-B alleles are associated with dermatitis herpetiformis in Chinese population.
26841353 KIR-3DL2 binding to HLA-B27 licenses Th17 cell differentiation in spondyloarthritis.
26819491 HLA-B13:02, HLA-B38:02, HLA-B44:03, and HLA-B56:01 alleles were significantly increased in autistic subjects. HLA-B18:02 and HLA-B46:12 alleles were negatively associated with autism when compared to normal controls.
26787826 The results show that natural polymorphisms within HIV-1 Nef modulate its interaction with natural polymorphisms in the HLA cytoplasmic tails, thereby affecting the efficiency of HLA downregulation and consequent recognition by HIV-specific T cells.
26758079 All three B*35 subtypes showed a tapasin-independent mode of peptide acquisition. HLA-B*35-restricted peptides of low- and high-binding affinities were recovered in the presence and absence of tapasin
26669670 The HLA-B*35 antigen contributes to endoplasmic reticulum stress and inflammation in limited cutaneous systemic sclerosis patients.
26640809 The functional IL-6 polymorphism rs1800795 is associated with intermediate uveitis but not with HLAB27 acute anterior uveitis.
26613595 four amino-acid positions of HLA-B and -C account for most of the associations between ankylosing spondylitis and MHC in the Korean population
26610302 Study replicated the HLA-B*27 association with acute anterior uveitis , and confirmed that HLA-B*27 homozygosity further increases the risk of AAU almost twofold.
26599303 we found a significant association between carbimazole/methimazole-induced agranulocytosis and HLA-B*38:02:01
More...

AA Sequence

MRVTAPRTVLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE      1 - 70
PRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQY     71 - 140
AYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRHLENGKETLQRADPPK    141 - 210
THVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASS    281 - 350
DSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (1699)

PMID Year Title
26967484 2016 The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population.
26841353 2016 Activation-Induced Killer Cell Immunoglobulin-like Receptor 3DL2 Binding to HLA-B27 Licenses Pathogenic T Cell Differentiation in Spondyloarthritis.
26819491 2015 Significant Association of HLA-B Alleles and Genotypes in Thai Children with Autism Spectrum Disorders: A Case-Control Study.
26787826 2016 Relative Resistance of HLA-B to Downregulation by Naturally Occurring HIV-1 Nef Sequences.
26758079 2016 Understanding the obstacle of incompatibility at residue 156 within HLA-B*35 subtypes.
26669670 2015 The HLA-B*35 allele modulates ER stress, inflammation and proliferation in PBMCs from Limited Cutaneous Systemic Sclerosis patients.
26640809 2015 Analysis of a Functional IL-6 Gene Polymorphism in HLAB27 Associated and Intermediate Uveitis Gives New Insight in Disease Pathogenesis and Commonality with Other Autoimmune Diseases.
26613595 2015 An HLA-C amino-acid variant in addition to HLA-B*27 confers risk for ankylosing spondylitis in the Korean population.
26610302 The genetic associations of acute anterior uveitis and their overlap with the genetics of ankylosing spondylitis.
26599303 2016 HLA-B*38:02:01 predicts carbimazole/methimazole-induced agranulocytosis.
More...