Property Summary

NCBI Gene PubMed Count 1,767
PubMed Score 1613.47
PubTator Score 6027.77

Knowledge Summary

Patent

No data available

 GO Function (1)

Gene RIF (1722)

AA Sequence

MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE      1 - 70
PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYNQL     71 - 140
AYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPK    141 - 210
THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASS    281 - 350
DSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (1771)

PMID Year Title