Property Summary

NCBI Gene PubMed Count 1,697
PubMed Score 1568.81
PubTator Score 6027.77

Knowledge Summary

Patent

No data available

Synonym

Accession P30488 O19615 O19624 O19641 O19783 O46702 O78172 Q9TQG1
Symbols AS
HLAB
B-4901

Gene

 GO Function (1)

Gene RIF (1702)

PMID Text
26967484 HLA-B alleles are associated with dermatitis herpetiformis in Chinese population.
26841353 KIR-3DL2 binding to HLA-B27 licenses Th17 cell differentiation in spondyloarthritis.
26819491 HLA-B13:02, HLA-B38:02, HLA-B44:03, and HLA-B56:01 alleles were significantly increased in autistic subjects. HLA-B18:02 and HLA-B46:12 alleles were negatively associated with autism when compared to normal controls.
26787826 The results show that natural polymorphisms within HIV-1 Nef modulate its interaction with natural polymorphisms in the HLA cytoplasmic tails, thereby affecting the efficiency of HLA downregulation and consequent recognition by HIV-specific T cells.
26758079 All three B*35 subtypes showed a tapasin-independent mode of peptide acquisition. HLA-B*35-restricted peptides of low- and high-binding affinities were recovered in the presence and absence of tapasin
26669670 The HLA-B*35 antigen contributes to endoplasmic reticulum stress and inflammation in limited cutaneous systemic sclerosis patients.
26640809 The functional IL-6 polymorphism rs1800795 is associated with intermediate uveitis but not with HLAB27 acute anterior uveitis.
26613595 four amino-acid positions of HLA-B and -C account for most of the associations between ankylosing spondylitis and MHC in the Korean population
26610302 Study replicated the HLA-B*27 association with acute anterior uveitis , and confirmed that HLA-B*27 homozygosity further increases the risk of AAU almost twofold.
26599303 we found a significant association between carbimazole/methimazole-induced agranulocytosis and HLA-B*38:02:01
More...

AA Sequence

MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE      1 - 70
PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYNQL     71 - 140
AYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPK    141 - 210
THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASS    281 - 350
DSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (1701)

PMID Year Title
26967484 2016 The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population.
26841353 2016 Activation-Induced Killer Cell Immunoglobulin-like Receptor 3DL2 Binding to HLA-B27 Licenses Pathogenic T Cell Differentiation in Spondyloarthritis.
26819491 2015 Significant Association of HLA-B Alleles and Genotypes in Thai Children with Autism Spectrum Disorders: A Case-Control Study.
26787826 2016 Relative Resistance of HLA-B to Downregulation by Naturally Occurring HIV-1 Nef Sequences.
26758079 2016 Understanding the obstacle of incompatibility at residue 156 within HLA-B*35 subtypes.
26669670 2015 The HLA-B*35 allele modulates ER stress, inflammation and proliferation in PBMCs from Limited Cutaneous Systemic Sclerosis patients.
26640809 2015 Analysis of a Functional IL-6 Gene Polymorphism in HLAB27 Associated and Intermediate Uveitis Gives New Insight in Disease Pathogenesis and Commonality with Other Autoimmune Diseases.
26613595 2015 An HLA-C amino-acid variant in addition to HLA-B*27 confers risk for ankylosing spondylitis in the Korean population.
26610302 The genetic associations of acute anterior uveitis and their overlap with the genetics of ankylosing spondylitis.
26599303 2016 HLA-B*38:02:01 predicts carbimazole/methimazole-induced agranulocytosis.
More...