Property Summary

NCBI Gene PubMed Count 1,767
PubMed Score 1613.47
PubTator Score 6027.77

Knowledge Summary

Patent

No data available

 GO Function (1)

 CSPA Cell Line (1)

Gene RIF (1722)

AA Sequence

MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE      1 - 70
PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTWQRMYGCDLGPDGRLLRGYNQL     71 - 140
AYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGLCVESLRRYLENGKETLQRADPPK    141 - 210
THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR    211 - 280
YTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASS    281 - 350
DSAQGSDVSLTA                                                              351 - 362
//

Text Mined References (1770)

PMID Year Title