Tbio | HLA class I histocompatibility antigen, A-43 alpha chain |
Involved in the presentation of foreign antigens to the immune system.
HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq, Jul 2008]
HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-A alleles have been described. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Juvenile rheumatoid arthritis | 105 | 0.0 | 5.0 |
Disease | Target Count |
---|---|
Birdshot chorioretinopathy | 23 |
PMID | Text |
---|---|
26974162 | Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients. |
26967484 | HLA-A alleles are associated with dermatitis herpetiformis in Chinese population. |
26787886 | Vitiligo risk associated with the MHC class I region thus derives from combined quantitative and qualitative phenomena: a SNP haplotype in a transcriptional regulator that induces gain-of-function, elevating expression of HLA-A RNA |
26656886 | the carriage of HLA-A SNP rs1655900 studied is not associated with the susceptibility to CT infection based on the data from the STD cohort. |
26621839 | Data indicate that adoptive transfer of peptide-induced cytotoxic T lymphocytes (CTL) cells from HLA-A2 transgenic mice into human tumor xenograft SCID mice significantly inhibited tumor growth. |
26600404 | This report presents results of a study of similarities and dissimilarities comparing all possible pairs of 43 high resolution X-ray structures of human HLA-A2. |
26564811 | expression on melanoma variants with B-Raf kinase inhibitors plays a major role in their susceptibility to NK-cell cytotoxicity |
26507656 | mutant N-terminally extended peptides exhibited significantly increased HLA-A*02:01 binding affinity and elicited CD8(+) T cell stimulation in vitro similar to the wtgp100209-217 epitope. |
26490229 | HLA-A*31:01 was confirmed to be significantly associated with definite/probable cases of Stevens-Johnson syndrome/toxic epidermal necrolysis |
26448174 | HLA-A*02:06 with Toll Like Receptor 3 polymorphisms and HLA-A*02:06 with prostaglandin e receptor-3 polymorphisms exerted additive effects in Stevens-Johnson Syndrome with Surface Ocular Complications |
More... |
MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME 1 - 70 PRAPWIEQEGPEYWDLQTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQD 71 - 140 AYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPK 141 - 210 THMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQR 211 - 280 YTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVIAGAVVAAVMWRRKSSDRKGGSYSQAASS 281 - 350 DSAQGSDMSLTACKV 351 - 365 //
PMID | Year | Title |
---|---|---|
26974162 | 2016 | Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients. |
26967484 | 2016 | The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population. |
26787886 | 2016 | Autoimmune vitiligo is associated with gain-of-function by a transcriptional regulator that elevates expression of HLA-A*02:01 in vivo. |
26656886 | 2016 | Potential protective effect of a G>A SNP in the 3'UTR of HLA-A for Chlamydia trachomatis symptomatology and severity of infection. |
26621839 | 2016 | A HLA-A2-restricted CTL epitope induces anti-tumor effects against human lung cancer in mouse xenograft model. |
26600404 | 2016 | Clusters of Structurally Similar MHC I HLA-A2 Molecules, Found with a New Method, Suggest Mechanisms of T-Cell Receptor Avidity. |
26564811 | 2016 | HLA class I downregulation is associated with enhanced NK-cell killing of melanoma cells with acquired drug resistance to BRAF inhibitors. |
26507656 | 2015 | The T210M Substitution in the HLA-a*02:01 gp100 Epitope Strongly Affects Overall Proteasomal Cleavage Site Usage and Antigen Processing. |
26490229 | 2015 | Development of a simple genotyping method for the HLA-A*31:01-tagging SNP in Japanese. |
26448174 | 2015 | Genetic Predisposition to Stevens-Johnson Syndrome With Severe Ocular Surface Complications. |
More... |