Property Summary

NCBI Gene PubMed Count 1,181
PubMed Score 4042.73
PubTator Score 2865.77

Knowledge Summary

Patent

No data available

Synonym

Accession P30453 P30454
Symbols HLAA

Gene

Gene RIF (1298)

PMID Text
26974162 Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients.
26967484 HLA-A alleles are associated with dermatitis herpetiformis in Chinese population.
26787886 Vitiligo risk associated with the MHC class I region thus derives from combined quantitative and qualitative phenomena: a SNP haplotype in a transcriptional regulator that induces gain-of-function, elevating expression of HLA-A RNA
26656886 the carriage of HLA-A SNP rs1655900 studied is not associated with the susceptibility to CT infection based on the data from the STD cohort.
26621839 Data indicate that adoptive transfer of peptide-induced cytotoxic T lymphocytes (CTL) cells from HLA-A2 transgenic mice into human tumor xenograft SCID mice significantly inhibited tumor growth.
26600404 This report presents results of a study of similarities and dissimilarities comparing all possible pairs of 43 high resolution X-ray structures of human HLA-A2.
26564811 expression on melanoma variants with B-Raf kinase inhibitors plays a major role in their susceptibility to NK-cell cytotoxicity
26507656 mutant N-terminally extended peptides exhibited significantly increased HLA-A*02:01 binding affinity and elicited CD8(+) T cell stimulation in vitro similar to the wtgp100209-217 epitope.
26490229 HLA-A*31:01 was confirmed to be significantly associated with definite/probable cases of Stevens-Johnson syndrome/toxic epidermal necrolysis
26448174 HLA-A*02:06 with Toll Like Receptor 3 polymorphisms and HLA-A*02:06 with prostaglandin e receptor-3 polymorphisms exerted additive effects in Stevens-Johnson Syndrome with Surface Ocular Complications
More...

AA Sequence

MAIMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME      1 - 70
PRAPWIEQEGPEYWDRNTRKVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQD     71 - 140
AYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPK    141 - 210
THMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQR    211 - 280
YTCHVQHEGLPKPLTLRWEPSSQPTIPIVGILAGLVLFGAVIAGAVVAAVMWRRKSSDRKGGSYSQAASS    281 - 350
DSAQGSDMSLTACKV                                                           351 - 365
//

Text Mined References (1184)

PMID Year Title
26974162 2016 Promiscuous Recognition of a Trypanosoma cruzi CD8+ T Cell Epitope among HLA-A2, HLA-A24 and HLA-A1 Supertypes in Chagasic Patients.
26967484 2016 The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population.
26787886 2016 Autoimmune vitiligo is associated with gain-of-function by a transcriptional regulator that elevates expression of HLA-A*02:01 in vivo.
26656886 2016 Potential protective effect of a G>A SNP in the 3'UTR of HLA-A for Chlamydia trachomatis symptomatology and severity of infection.
26621839 2016 A HLA-A2-restricted CTL epitope induces anti-tumor effects against human lung cancer in mouse xenograft model.
26600404 2016 Clusters of Structurally Similar MHC I HLA-A2 Molecules, Found with a New Method, Suggest Mechanisms of T-Cell Receptor Avidity.
26564811 2016 HLA class I downregulation is associated with enhanced NK-cell killing of melanoma cells with acquired drug resistance to BRAF inhibitors.
26507656 2015 The T210M Substitution in the HLA-a*02:01 gp100 Epitope Strongly Affects Overall Proteasomal Cleavage Site Usage and Antigen Processing.
26490229 2015 Development of a simple genotyping method for the HLA-A*31:01-tagging SNP in Japanese.
26448174 2015 Genetic Predisposition to Stevens-Johnson Syndrome With Severe Ocular Surface Complications.
More...