Property Summary

NCBI Gene PubMed Count 54
Grant Count 76
R01 Count 32
Funding $28,456,191.51
PubMed Score 217.56
PubTator Score 172.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -1.100 0.000
osteosarcoma -1.240 0.001
astrocytoma 1.100 0.003
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.400 0.001
primitive neuroectodermal tumor -1.100 0.011
lung cancer 1.400 0.006
adult high grade glioma -1.100 0.001
group 4 medulloblastoma -1.100 0.000
ovarian cancer 2.200 0.000
dermatomyositis 1.100 0.002

Synonym

Accession P30419 A8K7C1 Q9UE09
Symbols NMT

Gene

PANTHER Protein Class (1)

PDB

1RXT   3IU1   3IU2   3IWE   3JTK   4C2Y   4C2Z  

Gene RIF (52)

PMID Text
26603938 These observations point at a previously unrecognized contribution of calnexin to the retention of NMT1 at the ER membrane.
26074144 findings suggest that both NMT1 and hnRNP A2/B1 take part in the regulation of HIV-1 RNA expression through their mutual opposite effects on the viral RNA expression in HIV-1-producing cells
23184449 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21653836 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21449607 we propose a model of the Nef:NMT complex in which only the myristoyl moiety holds the two proteins together in complex and speculate that perhaps NMT chaperones Nef to the membrane and thereby protects the myristic acid group from the cytosol
21449607 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19403686 HIV-1 Nef is identified to have a physical interaction with N-myristoyltransferase 1 (NMT1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
18248763 These results strongly suggest that HIV-1 production is specifically associated with hNMT1, particularly hNMT1(L), but not with hNMT2 in vivo, contributing to the understanding of a step in HIV-1 replication.
More...

AA Sequence

MADESETAVKPPAPPLPQMMEGNGNGHEHCSDCENEEDNSYNRGGLSPANDTGAKKKKKKQKKKKEKGSE      1 - 70
TDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTHGPVEP     71 - 140
DKDNIRQEPYTLPQGFTWDALDLGDRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQW    141 - 210
HCGVRVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLIREITRRVHLEGIFQAV    211 - 280
YTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHLSRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVH    281 - 350
QLLTRYLKQFHLTPVMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHKSLKAAY    351 - 420
SFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWKCPSMGAEK    421 - 490
VGLVLQ                                                                    491 - 496
//

Text Mined References (62)

PMID Year Title
26603938 2015 N-Myristoyltransferase 1 interacts with calnexin at the endoplasmic reticulum.
26074144 2015 N-Myristoyltransferase 1 enhances human immunodeficiency virus replication through regulation of viral RNA expression level.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21449607 2011 Effects of HIV-1 Nef on human N-myristoyltransferase 1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...