Property Summary

Ligand Count 310
NCBI Gene PubMed Count 199
PubMed Score 0.00
PubTator Score 346.38

Knowledge Summary

Patent (12,693)

Expression

  Differential Expression (6)

Disease log2 FC p
cystic fibrosis 3.435 1.1e-04
group 4 medulloblastoma -1.100 1.7e-03
invasive ductal carcinoma -1.299 3.2e-02
lung adenocarcinoma 1.500 3.4e-05
lung cancer -1.400 4.4e-04
malignant mesothelioma -4.700 8.7e-10

Protein-protein Interaction (1)

Gene RIF (189)

AA Sequence

MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQPPFLWVLFVL      1 - 70
ATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNNFDWLFGETLCRVVNAIISMN     71 - 140
LYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLVFRTMKEYSDEGHNVTA    141 - 210
CVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFI    211 - 280
ICWLPFQISTFLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGV    281 - 350
CQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ                                 351 - 391
//

Text Mined References (199)

PMID Year Title