Property Summary

NCBI Gene PubMed Count 188
PubMed Score 0.00
PubTator Score 346.38

Knowledge Summary

Patent (12,693)


Accession P30411 B2R
Symbols B2R


PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

  TechDev Info (1)

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
686926 other 0 / 0 / 1 ML354 Eurofin Panel Assay for PAR4 Antagonists Inhibitor (Probe Compound)
686927 other 0 / 0 / 1 ML353 Eurofin Panel Assay for mGlu5 SAM Inhibitor (Probe Compound)
743249 screening 1 / 0 / 0 Development of the First Potent, Selective and CNS penetrant M5 Negative Allosteric Modulator (NAM)

Gene RIF (178)

26907838 These results suggest that the response to long-term exercise training could be modulated by the BDKRB2 gene -9/+9 polymorphism in male athletes. In well-trained swimmers, BDKRB2 gene variation was not found to be an independent determinant of swimming performance.
26362411 Significant association between the -58T/C polymorphism and the increased risk of Hypertension was found in Northern Han Chinese population.
26360782 Bradykinin inhibits oxidative stress-induced senescence of endothelial progenitor cells through the B2R/AKT/RB and B2R/EGFR/RB signal pathways.
26235941 A cross-talk was found between bradykinin B2 receptor and cytokines in retinal pigment epithelium.
25970620 The nasal mucosa specimens from chronic rhinosinusitis patients expressed relatively higher B2R and slightly higher kininogen (KNG)/BK and B1R.
25842860 Bradykinin receptor B2-VNTR length polymorphism was not associated with angina pectoris and myocardial infarction in Russian men.
25713410 These results indicate that B2R couples with P2Y2R and that these G-protein-coupled receptors act together to fine-tune cellular responsiveness.
25641172 Bradykinin receptor B2 (B2R) genetic variation may affect thirst because of effects bradykinin activity.
25529519 Genetic variation was observed in obese patients with hypertension, obese patients' total cholesterol levels varied by genotype, and waist circumference and blood pressure were elevated in the non-obese having a C/C genotype compared to T/C and T/T.
25289859 kB1R heterodimerizes with kB2Rs in co-transfected HEK293 cells and natively expressing endothelial cells, resulting in significant internalization and desensitization of the kB1R response in cells pre-treated with kB2R agonist.

AA Sequence

CQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ                                 351 - 391

Text Mined References (188)

PMID Year Title
26907838 2016 Effect of BDKRB2 Gene -9/+9 Polymorphism on Training Improvements in Competitive Swimmers.
26362411 2016 Association of the bradykinin receptors genes variants with hypertension: a case-control study and meta-analysis.
26360782 2015 Bradykinin inhibits oxidative stress-induced senescence of endothelial progenitor cells through the B2R/AKT/RB and B2R/EGFR/RB signal pathways.
26235941 2015 Enhanced Ca(2+) response and stimulation of prostaglandin release by the bradykinin B2 receptor in human retinal pigment epithelial cells primed with proinflammatory cytokines.
25970620 2015 Involvement of B2 receptor in bradykinin-induced proliferation and proinflammatory effects in human nasal mucosa-derived fibroblasts isolated from chronic rhinosinusitis patients.
25842860 [[Length polymorphism of minisatellite repeat B2-VNTR of the bradykinin B2 receptor gene in healthy Russians and in patients with coronary heart disease].
25713410 2015 Close association of B2 bradykinin receptors with P2Y2 ATP receptors.
25641172 2015 The influence of angiotensin converting enzyme and bradykinin receptor B2 gene variants on voluntary fluid intake and fluid balance in healthy men during moderate-intensity exercise in the heat.
25529519 2014 The relationship of Bradykinin B? receptor gene variation with obesity, hypertension and lipid variables in obese patients.
25289859 2015 Downregulation of kinin B1 receptor function by B2 receptor heterodimerization and signaling.