Property Summary

NCBI Gene PubMed Count 28
Grant Count 3
R01 Count 3
Funding $218,119.83
PubMed Score 45.87
PubTator Score 98.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Gene RIF (16)

PMID Text
26709920 The findings suggest that TM4SF1 is a surface membrane antigen that is highly expressed in pancreatic cancer cells and increases the chemoresistance to gemcitabine. TM4SF1 may be a promising target to overcome the chemoresistance of pancreatic cancer.
26464650 TM4SF1 overexpression significantly contributed MDA-MB-231 cell migration but decreased apoptotic cells
26241677 These findings validate TM4SF1 as an attractive candidate for cancer therapy with antibody-bound toxins that have the capacity to react with either cytoplasmic or nuclear targets in tumor cells or tumor-associated vascular endothelium.
26035794 Study shows that TM4SF1 expression is associated with better prognosis in pancreatic cancer. Its loss contributes to the invasion and migration of pancreatic cancer cells.
25872484 We found that miR-203 was significantly downregulated in OSF tissues compared to that in normal buccal mucosa tissues, and that miR-203 negatively regulated secreted SFRP4 and positively regulated TM4SF1
25855954 Transmembrane-4-L-six-family-1 is overexpressed in human gliomas in general and the precise level of expression might predict outcome and could be of clinical value.
24986520 TM4SF1 is a small plasma membrane glycoprotein that regulates cell motility and proliferation, and possibly a new vascular therapeutic target in cancer
24285464 High TM4SF1 expression is associated with pancreatic cancer.
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of transmembrane 4 L six family member 1 (TM4SF1; L6) in peptide-treated PBMCs
21656834 Inhibition of cell migration after targeted knockdown of TM4SF1 protein expression suggests its contribution to prostate cancer cell metastasis.
More...

AA Sequence

MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLMLLPAFVFIGL      1 - 70
EQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYL     71 - 140
LDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQYDC            141 - 202
//

Text Mined References (29)

PMID Year Title
26709920 2015 TM4SF1 Promotes Gemcitabine Resistance of Pancreatic Cancer In Vitro and In Vivo.
26464650 2015 Role of TM4SF1 in regulating breast cancer cell migration and apoptosis through PI3K/AKT/mTOR pathway.
26241677 2015 Intracellular distribution of TM4SF1 and internalization of TM4SF1-antibody complex in vascular endothelial cells.
26035794 2015 TM4SF1 as a prognostic marker of pancreatic ductal adenocarcinoma is involved in migration and invasion of cancer cells.
25872484 2015 miR-203 inhibits arecoline-induced epithelial-mesenchymal transition by regulating secreted frizzled-related protein 4 and transmembrane-4 L six family member 1 in oral submucous fibrosis.
25855954 2015 Transmembrane-4-L-six-family-1, a potential predictor for poor prognosis, overexpressed in human glioma.
24986520 2014 TM4SF1: a new vascular therapeutic target in cancer.
24285464 2014 hsa-miR-141 downregulates TM4SF1 to inhibit pancreatic cancer cell invasion and migration.
21656834 2011 TM4SF1, a novel primary androgen receptor target gene over-expressed in human prostate cancer and involved in cell migration.
21626280 2011 TM4SF1: a tetraspanin-like protein necessary for nanopodia formation and endothelial cell migration.
More...