Property Summary

NCBI Gene PubMed Count 33
PubMed Score 47.86
PubTator Score 98.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical adenoma -1.131 1.3e-02
adrenocortical carcinoma -1.680 2.1e-03
Astrocytoma, Pilocytic 2.200 1.3e-06
autosomal dominant Emery-Dreifuss muscul... 1.046 4.0e-02
Breast cancer 1.700 2.5e-02
colon cancer 1.100 4.0e-02
dermatomyositis 1.400 1.8e-02
Endometriosis -1.146 3.8e-02
glioblastoma 1.300 3.7e-03
interstitial cystitis 1.200 1.4e-04
interstitial lung disease -1.600 3.3e-02
intraductal papillary-mucinous adenoma (... 1.400 1.6e-02
invasive ductal carcinoma -1.542 2.6e-03
juvenile dermatomyositis 1.112 9.4e-07
lung cancer -4.100 8.4e-06
lung carcinoma -2.200 5.8e-19
malignant mesothelioma -1.200 1.4e-06
medulloblastoma, large-cell -1.200 1.2e-02
nephrosclerosis 1.194 2.3e-04
ovarian cancer -2.300 1.3e-05
pancreatic cancer 1.700 1.5e-07
pancreatic ductal adenocarcinoma liver m... 2.220 4.1e-02
pediatric high grade glioma 1.200 3.5e-03
Polycystic ovary syndrome 1.038 4.1e-02
psoriasis -1.600 3.3e-04
spina bifida -2.762 3.1e-02
ulcerative colitis 1.500 1.4e-03

Synonym

Accession P30408 Q6IB51
Symbols L6
H-L6
M3S1
TAAL6

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (21)

AA Sequence

MCYGKCARCIGHSLVGLALLCIAANILLYFPNGETKYASENHLSRFVWFFSGIVGGGLLMLLPAFVFIGL      1 - 70
EQDDCCGCCGHENCGKRCAMLSSVLAALIGIAGSGYCVIVAALGLAEGPLCLDSLGQWNYTFASTEGQYL     71 - 140
LDTSTWSECTEPKHIVEWNVSLFSILLALGGIEFILCLIQVINGVLGGICGFCCSHQQQYDC            141 - 202
//

Text Mined References (34)

PMID Year Title