Property Summary

NCBI Gene PubMed Count 21
Grant Count 190
R01 Count 93
Funding $21,441,922.78
PubMed Score 410.65
PubTator Score 117.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma 1.300 0.034
psoriasis 2.400 0.000
osteosarcoma -1.492 0.014
posterior fossa group A ependymoma 2.000 0.000
tuberculosis -2.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.498 0.005
non-small cell lung cancer 1.597 0.000
lung cancer 1.400 0.000
lung adenocarcinoma 1.098 0.000
breast carcinoma 1.300 0.000
spina bifida -1.492 0.038
ovarian cancer 1.500 0.001
Breast cancer 1.200 0.001
Down syndrome 1.100 0.003
pancreatic cancer -1.100 0.010

Synonym

Accession P30405 Q2YDB7 Q5W131 PPIase F
Symbols CYP3
CypD
CyP-M
Cyp-D

Gene

PANTHER Protein Class (1)

PDB

2BIT   2BIU   2Z6W   3QYU   3R49   3R4G   3R54   3R56   3R57   3R59   3RCF   3RCG   3RCI   3RCK   3RCL   3RD9   3RDA   3RDB   3RDC   4J58   4J59   4J5A   4J5B   4J5C   4J5D   4J5E   4O8H   4O8I   4XNC   4ZSC   4ZSD   5A0E   5CBT   5CBU   5CBV   5CBW   5CCN   5CCQ   5CCR   5CCS  

Gene RIF (7)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase F protein (PPIF, cyclophilin F) is identified by yeast two-hybrid screen
20877624 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18614807 There was increased [Ca(2+)](c), [Ca(2+)](m), mCICR, MPTP opening, and expression of cyclophilin D and decreased DeltaPsim in POAG TM cells compared with control cells.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12077116 Cyclophilin D protects cell from cell death.

AA Sequence

MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADV      1 - 70
VPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVL     71 - 140
SMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS       141 - 207
//

Text Mined References (31)

PMID Year Title
26976564 2016 Mitochondrial calcium uniporter regulator 1 (MCUR1) regulates the calcium threshold for the mitochondrial permeability transition.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22726440 2012 p53 opens the mitochondrial permeability transition pore to trigger necrosis.
21930693 2011 Cysteine 203 of cyclophilin D is critical for cyclophilin D activation of the mitochondrial permeability transition pore.
21904027 2011 In-plate protein crystallization, in situ ligand soaking and X-ray diffraction.
21269460 2011 Initial characterization of the human central proteome.
20950273 2011 Complement 1q-binding protein inhibits the mitochondrial permeability transition pore and protects against oxidative stress-induced death.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...