Property Summary

NCBI Gene PubMed Count 21
PubMed Score 410.65
PubTator Score 117.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Intestinal Diseases 5
Ulcer 2
Disease Target Count P-value
breast carcinoma 1614 5.06017666638854E-12
non-small cell lung cancer 2798 5.0964485268398E-12
posterior fossa group A ependymoma 1511 8.78934444035692E-9
psoriasis 6685 2.25711633540904E-7
tuberculosis 1563 1.68105886609972E-4
lung adenocarcinoma 2714 2.53688586104989E-4
lung cancer 4473 4.71630889204426E-4
ovarian cancer 8492 5.19066100112537E-4
Breast cancer 3099 6.21790938544725E-4
Down syndrome 548 0.00332228618266334
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00468425504666904
pancreatic cancer 2300 0.00977646839413096
osteosarcoma 7933 0.0135076884746975
oligodendroglioma 2849 0.0335245418277241
spina bifida 1064 0.0378209677278708
Disease Target Count Z-score Confidence
Vascular disease 281 3.729 1.9
Alzheimer's disease 644 3.436 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
oligodendroglioma 1.300 0.034
psoriasis 2.400 0.000
osteosarcoma -1.492 0.014
posterior fossa group A ependymoma 2.000 0.000
tuberculosis -2.400 0.000
pancreatic ductal adenocarcinoma liver m... -1.498 0.005
non-small cell lung cancer 1.597 0.000
lung cancer 1.400 0.000
lung adenocarcinoma 1.098 0.000
breast carcinoma 1.300 0.000
spina bifida -1.492 0.038
ovarian cancer 1.500 0.001
Breast cancer 1.200 0.001
Down syndrome 1.100 0.003
pancreatic cancer -1.100 0.010

Synonym

Accession P30405 Q2YDB7 Q5W131 PPIase F
Symbols CYP3
CypD
CyP-M
Cyp-D

Gene

PANTHER Protein Class (1)

PDB

2BIT   2BIU   2Z6W   3QYU   3R49   3R4G   3R54   3R56   3R57   3R59   3RCF   3RCG   3RCI   3RCK   3RCL   3RD9   3RDA   3RDB   3RDC   4J58   4J59   4J5A   4J5B   4J5C   4J5D   4J5E   4O8H   4O8I   4XNC   4ZSC   4ZSD   5A0E   5CBT   5CBU   5CBV   5CBW   5CCN   5CCQ   5CCR   5CCS  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus EggNOG Inparanoid
Zebrafish EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG

Gene RIF (7)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular peptidylprolyl isomerase F protein (PPIF, cyclophilin F) is identified by yeast two-hybrid screen
20877624 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18614807 There was increased [Ca(2+)](c), [Ca(2+)](m), mCICR, MPTP opening, and expression of cyclophilin D and decreased DeltaPsim in POAG TM cells compared with control cells.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12077116 Cyclophilin D protects cell from cell death.

AA Sequence

MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADV      1 - 70
VPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVL     71 - 140
SMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS       141 - 207
//

Text Mined References (31)

PMID Year Title
26976564 2016 Mitochondrial calcium uniporter regulator 1 (MCUR1) regulates the calcium threshold for the mitochondrial permeability transition.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
22726440 2012 p53 opens the mitochondrial permeability transition pore to trigger necrosis.
21930693 2011 Cysteine 203 of cyclophilin D is critical for cyclophilin D activation of the mitochondrial permeability transition pore.
21904027 2011 In-plate protein crystallization, in situ ligand soaking and X-ray diffraction.
21269460 2011 Initial characterization of the human central proteome.
20950273 2011 Complement 1q-binding protein inhibits the mitochondrial permeability transition pore and protects against oxidative stress-induced death.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...