Property Summary

NCBI Gene PubMed Count 130
Grant Count 141
R01 Count 117
Funding $8,051,907.98
PubMed Score 295.28
PubTator Score 477.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Synonym

Accession P30307 D3DQB8 Q96PL3 Q9H168 Q9H2E8 Q9H2E9 Q9H2F1
Symbols CDC25
PPP1R60

Gene

PDB

2OJX   3BZI   3OP3  

 GWAS Trait (1)

Gene RIF (105)

PMID Text
26805039 These miR-142-3p functioned as a tumor suppressor by targeting CDC25C.
26595675 Suggest that the p53-p21-DREAM-CDE/CHR pathway regulates p53-dependent repression of Survivin, CDC25C, and PLK1 in HCT116 cells.
26474275 Data indicate that nine compounds were identified with Ki values for CDC25A, -B and -C ranging from 0.01 to 4.4 muM.
25633196 Cdc25C negatively regulates proapoptotic ASK1 in a cell cycle-dependent manner and may play a role in G2/M checkpoint-mediated apoptosis.
25397735 CDC25C seems important for the phenotype of AML cells at least for a subset of patients. Many of the identified CDC25 inhibitors show cross-reactivity among the three CDC25 isoforms.
25340978 for the first time, we demonstrated that CTD induced G2/M phase arrest via the inhibition of Cdc25c and cyclin A and induced apoptosis was through death receptor (extrinsic), intrinsic (mitochondria) and ER stress pathways in A375. S2 cells.
25159113 Recurrent CDC25C mutations drive malignant transformation in familial platelet disorder to acute myelogenous leukaemia.
24626146 we conclude that inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through the transcriptional upregulation of CDC25C.
24158819 Kinase Srk1 is required for the Vpr-mediated nuclear export of Cdc25
24032677 calmodulin is a regulatory molecule that associates with Plk1 from G2 to metaphase resulting in considerable stimulation of Plk1 kinase activity leading to hyperphosphorylation of Cdc25C.
More...

AA Sequence

MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKR      1 - 70
CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK     71 - 140
RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG    141 - 210
LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG    211 - 280
HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ    281 - 350
EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF    351 - 420
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP                     421 - 473
//

Text Mined References (135)

PMID Year Title
26805039 2016 miR-142-3p inhibits cancer cell proliferation by targeting CDC25C.
26595675 2015 Indirect p53-dependent transcriptional repression of Survivin, CDC25C, and PLK1 genes requires the cyclin-dependent kinase inhibitor p21/CDKN1A and CDE/CHR promoter sites binding the DREAM complex.
26474275 2015 Ligand-based chemoinformatic discovery of a novel small molecule inhibitor targeting CDC25 dual specificity phosphatases and displaying in vitro efficacy against melanoma cells.
25633196 2015 Cell cycle-dependent Cdc25C phosphatase determines cell survival by regulating apoptosis signal-regulating kinase 1.
25397735 2014 Therapeutic targeting the cell division cycle 25 (CDC25) phosphatases in human acute myeloid leukemia--the possibility to target several kinases through inhibition of the various CDC25 isoforms.
25340978 2014 Cantharidin induces G2/M phase arrest by inhibition of Cdc25c and Cyclin A and triggers apoptosis through reactive oxygen species and the mitochondria?dependent pathways of A375.S2 human melanoma cells.
25159113 2014 Recurrent CDC25C mutations drive malignant transformation in FPD/AML.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24626146 2014 Inhibition of KIF22 suppresses cancer cell proliferation by delaying mitotic exit through upregulating CDC25C expression.
24032677 2013 Calmodulin activation of polo-like kinase 1 is required during mitotic entry.
More...