Property Summary

Ligand Count 9
NCBI Gene PubMed Count 144
PubMed Score 308.28
PubTator Score 477.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adrenocortical carcinoma 1.378 1.4e-03
atypical teratoid / rhabdoid tumor 1.400 3.7e-05
Breast cancer 1.800 1.1e-14
Endometriosis 1.030 1.8e-02
glioblastoma 1.200 1.0e-05
group 3 medulloblastoma 2.800 1.5e-07
intraductal papillary-mucinous neoplasm ... 1.500 9.2e-04
lung adenocarcinoma 1.300 3.0e-10
lung cancer 1.800 1.4e-03
malignant mesothelioma 2.300 1.1e-06
medulloblastoma, large-cell 1.600 1.3e-04
non-small cell lung cancer 1.248 2.4e-18
ovarian cancer 1.300 1.1e-06
pediatric high grade glioma 1.200 1.0e-04
primitive neuroectodermal tumor 1.500 1.1e-03
psoriasis 1.500 9.1e-70

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (101)

AA Sequence

MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKR      1 - 70
CLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRK     71 - 140
RDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSG    141 - 210
LYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQG    211 - 280
HLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQ    281 - 350
EELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF    351 - 420
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP                     421 - 473
//

Text Mined References (149)

PMID Year Title