Property Summary

Ligand Count 54
NCBI Gene PubMed Count 107
PubMed Score 216.42
PubTator Score 166.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.002 1.4e-02
adrenocortical carcinoma 1.688 4.8e-06
Atopic dermatitis 1.700 1.2e-05
Breast cancer 1.100 1.4e-05
esophageal adenocarcinoma 1.200 2.7e-02
gastric carcinoma 1.900 2.8e-02
interstitial cystitis 1.400 9.0e-03
intraductal papillary-mucinous carcinoma... 2.500 7.0e-04
intraductal papillary-mucinous neoplasm ... 1.900 9.8e-04
malignant mesothelioma 1.100 1.5e-06
osteosarcoma -1.726 2.3e-05
psoriasis 1.600 8.4e-117
ulcerative colitis 1.800 7.3e-08

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (68)

AA Sequence

MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETP      1 - 70
KSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIR     71 - 140
NEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSS    141 - 210
THALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLK    211 - 280
DDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKR    281 - 350
RRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM    351 - 420
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFS    421 - 490
SERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLK    491 - 560
TRSWAGERSRRELCSRLQDQ                                                      561 - 580
//

Text Mined References (112)

PMID Year Title