Property Summary

NCBI Gene PubMed Count 104
Grant Count 78
R01 Count 57
Funding $5,461,383.66
PubMed Score 209.24
PubTator Score 166.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene

PDB

3FQT   3FQU   1CWR   1CWS   1CWT   1QB0   1YM9   1YMD   1YMK   1YML   1YS0   2A2K   2IFD   2IFV   2UZQ   4WH7   4WH9  

 GWAS Trait (1)

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
368 screening 84 / 0 / 65138 Cdc25B Catalytic Domain protein tyrosine phosphatase HTS
443 confirmatory 6 / 0 / 0 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Dose Response Confirmation and Secondary Selectivity/Specificity Assay
569 confirmatory 29 / 0 / 55 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase HTS Dose Response Confirmation Assay
649 confirmatory 14 / 0 / 15 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in 25 mM DTT
650 confirmatory 25 / 0 / 4 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response Reproducibility Assay
668 confirmatory 18 / 0 / 11 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Catalase.
669 confirmatory 8 / 0 / 21 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in 25 mM DTT and Catalase.
670 confirmatory 15 / 0 / 14 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Beta-Mercaptoethanol.
671 confirmatory 14 / 0 / 15 Cdc25B Catalytic Domain Protein Tyrosine Phosphatase Probe Assessment Dose Response assay in the presence of Glutathione.
676 confirmatory 23 / 0 / 23 MKP-1 Dual Specificity Protein Tyrosine Phosphatase Probe Assessment: Cdc25B Dose Response Selectivity Assay

Gene RIF (65)

PMID Text
26474275 Data indicate that nine compounds were identified with Ki values for CDC25A, -B and -C ranging from 0.01 to 4.4 muM.
25775393 High CDC25B expression is associated with esophageal carcinoma.
25680404 For the first time, we demonstrate that miRNA-211 is a direct negative regulator of CDC25B expression in TNBC cells, alters other related target proteins CCNB1 and FOXM1, and then inhibits breast cancer cells growth, migration, and invasion
25384584 FK-3000 exerts its antiproliferative effect through G2/M cell cycle arrest via downregulation of cyclin B and phospho-CDC2 by p38 MAPK phosphorylation and CDC25B dephosphorylation .
25326518 Our results suggest that expression of CDC25B may be used as a potential prognostic marker in the pathogenesis of retinoblastoma.
24740794 Solution NMR studies reveal no global flexibility in the structure of CDC25b catalytic domain
24344030 Positive expression of CDC25B in astrocytoma affects the prognosis in an adverse manner.
24234332 Cdc25B upregulation and 14-3-3sigma downregulation might promote development of bladder cancer and suggested a poor prognosis.
24109234 CDC25B is a pro-influenza A virus host factor.
23908401 Phosphorylation and inhibition of cdc25B causes delayed progression from G2 into mitosis in melanoma cells.
More...

AA Sequence

MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMHDLAGLGSETP      1 - 70
KSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMDPHMAEQTFEQAIQAASRIIR     71 - 140
NEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEAGSGAASSSGEDKENDGFVFKMPWKPTHPSS    141 - 210
THALAEWASRREAFAQRPSSAPDLMCLSPDRKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLK    211 - 280
DDDAVPPGMESLISAPLVKTLEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKR    281 - 350
RRSVTPPEEQQEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM    351 - 420
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKRVILIFHCEFS    421 - 490
SERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDELKTFRLK    491 - 560
TRSWAGERSRRELCSRLQDQ                                                      561 - 580
//

Text Mined References (109)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26474275 2015 Ligand-based chemoinformatic discovery of a novel small molecule inhibitor targeting CDC25 dual specificity phosphatases and displaying in vitro efficacy against melanoma cells.
25775393 2015 Expression and significance of CDC25B, PED/PEA-15 in esophageal carcinoma.
25680404 2015 MicroRNA-211, a direct negative regulator of CDC25B expression, inhibits triple-negative breast cancer cells' growth and migration.
25384584 2015 6,7-di-O-acetylsinococuline (FK-3000) induces G2/M phase arrest in breast carcinomas through p38 MAPK phosphorylation and CDC25B dephosphorylation.
25326518 2015 Expression of CDC25A and CDC25B phosphatase proteins in human retinoblastoma and its correlation with clinicopathological parameters.
24740794 2014 Solution NMR studies reveal no global flexibility in the catalytic domain of CDC25B.
24344030 CDC25B, Ki-67, and p53 expressions in reactive gliosis and astrocytomas.
24234332 2014 High expression of Cdc25B and low expression of 14-3-3? is associated with the development and poor prognosis in urothelial carcinoma of bladder.
24109234 2013 Targeting cell division cycle 25 homolog B to regulate influenza virus replication.
More...