Property Summary

Ligand Count 19
NCBI Gene PubMed Count 148
PubMed Score 278.54
PubTator Score 246.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.293 3.4e-03
adult high grade glioma 1.100 2.4e-02
atypical teratoid / rhabdoid tumor 1.600 2.9e-07
Breast cancer 1.100 2.0e-04
colon cancer 1.300 2.5e-02
ductal carcinoma in situ 1.100 4.3e-03
facioscapulohumeral dystrophy 1.600 1.5e-02
glioblastoma 1.300 1.7e-03
group 3 medulloblastoma 1.500 7.6e-05
intraductal papillary-mucinous carcinoma... 1.400 5.2e-04
lung cancer 1.900 1.7e-03
malignant mesothelioma 1.900 5.9e-08
medulloblastoma, large-cell 3.200 5.1e-06
non-small cell lung cancer 1.497 2.9e-15
osteosarcoma -2.044 2.5e-03
ovarian cancer 1.300 1.6e-04
primitive neuroectodermal tumor 2.500 1.3e-03
psoriasis 1.900 3.4e-127

 GO Component (2)

Protein-protein Interaction (4)

Gene RIF (107)

AA Sequence

MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYEQPLEVKNNSN      1 - 70
LQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALKRSHSDSLDHDIFQLIDPDEN     71 - 140
KENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAPARMLSSNERDSSEPGNFIPLFTPQSPVTAT    141 - 210
LSDEDDGFVDLLDGENLKNEEETPSCMASLWTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQ    211 - 280
EESPPGSTKRRKSMSGASPKESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTV    281 - 350
AGKHQDLKYISPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT    351 - 420
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSYCEPPSYRPMH    421 - 490
HEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL                                        491 - 524
//

Text Mined References (151)

PMID Year Title