Property Summary

NCBI Gene PubMed Count 140
PubMed Score 265.96
PubTator Score 246.05

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.40890441296869E-127
non-small cell lung cancer 2798 2.91127928197734E-15
malignant mesothelioma 3163 5.88723181904905E-8
atypical teratoid / rhabdoid tumor 4369 2.92503001914266E-7
lung cancer 4473 3.89628161395993E-7
group 3 medulloblastoma 2254 2.51617892517411E-6
medulloblastoma, large-cell 6234 5.12340650405554E-6
pediatric high grade glioma 2712 1.20633873105501E-5
ovarian cancer 8492 1.57826459636768E-4
glioblastoma 5572 1.65005137782614E-4
Breast cancer 3099 1.95897695298979E-4
osteosarcoma 7933 2.78011675250292E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.19355951311704E-4
primitive neuroectodermal tumor 3031 0.00130322218661877
adrenocortical carcinoma 1427 0.00336706613901952
ductal carcinoma in situ 1745 0.00431143025222258
facioscapulohumeral dystrophy 286 0.0152445135600016
colon cancer 1475 0.0253281020698162
Disease Target Count Z-score Confidence
Cancer 2346 4.904 2.5


  Differential Expression (18)


Accession P30304 Q8IZH5 Q96IL3 Q9H2F2
Symbols CDC25A2




  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA Inparanoid

 GO Component (2)

Gene RIF (100)

26647881 This study demonstrated that the cell cycle pathway and the cdc25a gene may be crucial in the pathogenesis and progression of hepatocellular carcinoma.
26515730 Identify CDC25A as an early cell cycle transducer of FLT3-ITD oncogenic signaling, and as a promising target to inhibit proliferation and re-induce differentiation of FLT3-ITD acute myeloid leukemia cells.
26474275 Data indicate that nine compounds were identified with Ki values for CDC25A, -B and -C ranging from 0.01 to 4.4 muM.
25990966 Increased CDC25A is associated with invasiveness in Non-small Cell Lung Cancer.
25936524 STK38-mediated phosphorylation of CDC25A at Ser-76 and the subsequent degradation of CDC25A are required to promote DNA damage-induced G2/M checkpoint activation.
25909324 let-7c suppresses HCC progression, possibly by directly targeting the cell cycle regulator CDC25A and indirectly affecting its downstream target molecules. Let-7c may therefore be an effective therapeutic target for HCC.
25397735 CDC25C seems important for the phenotype of AML cells at least for a subset of patients. Many of the identified CDC25 inhibitors show cross-reactivity among the three CDC25 isoforms.
25378484 These results suggest that Cdc25a promotes human cytomegalovirus replication and elevation of Cdc25a levels after human cytomegalovirus infection are due in part to human cytomegalovirus-mediated repression of miR-21.
25326518 Our results suggest that expression of CDC25B may be used as a potential prognostic marker in the pathogenesis of retinoblastoma.
25266660 miR-424(322)/503-dependent posttranscriptional downregulation of CDC25A cooperates with transcriptional repression of the CDC25A promoter and proteasome-mediated degradation to reduce the levels of CDC25A expression and to induce cell cycle arrest.

AA Sequence

HEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL                                        491 - 524

Text Mined References (143)

PMID Year Title
26647881 2016 Identification of key genes in hepatocellular carcinoma and validation of the candidate gene, cdc25a, using gene set enrichment analysis, meta-analysis and cross-species comparison.
26515730 2015 CDC25A governs proliferation and differentiation of FLT3-ITD acute myeloid leukemia.
26474275 2015 Ligand-based chemoinformatic discovery of a novel small molecule inhibitor targeting CDC25 dual specificity phosphatases and displaying in vitro efficacy against melanoma cells.
25990966 2015 MicroRNA-184 Deregulated by the MicroRNA-21 Promotes Tumor Malignancy and Poor Outcomes in Non-small Cell Lung Cancer via Targeting CDC25A and c-Myc.
25936524 2015 Serine-Threonine Kinase 38 regulates CDC25A stability and the DNA damage-induced G2/M checkpoint.
25909324 2015 MicroRNA let-7c Inhibits Cell Proliferation and Induces Cell Cycle Arrest by Targeting CDC25A in Human Hepatocellular Carcinoma.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25397735 2014 Therapeutic targeting the cell division cycle 25 (CDC25) phosphatases in human acute myeloid leukemia--the possibility to target several kinases through inhibition of the various CDC25 isoforms.
25378484 2015 MicroRNA miR-21 attenuates human cytomegalovirus replication in neural cells by targeting Cdc25a.
25326518 2015 Expression of CDC25A and CDC25B phosphatase proteins in human retinoblastoma and its correlation with clinicopathological parameters.