Property Summary

NCBI Gene PubMed Count 100
Grant Count 190
R01 Count 139
Funding $14,152,402.26
PubMed Score 288.31
PubTator Score 183.69

Knowledge Summary

Patent (15,143)

Expression

Synonym

Accession P30291 B3KVE1 D3DQV0 WEE1hu
Symbols WEE1A
WEE1hu

Gene

PDB

1X8B   2IN6   2IO6   2Z2W   3BI6   3BIZ   3CQE   3CR0  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (102)

PMID Text
26645158 These results suggest that the G2 checkpoint inhibitor MK-1775 can enhance the sensitivity of human NSCLC cells to C ions as well as X rays.
26602815 Data show that H3K36me3-deficient cancers can be targeted by inhibition of WEE1 protein.
26598692 data indicate that the activity of the DNA replication machinery, beyond TP53 mutation status, determines Wee1 inhibitor sensitivity, and could serve as a selection criterion for Wee1-inhibitor eligible patients
26431163 Data show that proto-oncogene protein Mdm2 inactivation successfully protects tumor suppressor protein (p53)-proficient cells against the cytotoxic effects of Wee1 protein inhibition.
26054341 These data provide a rationale for further evaluation of the combination of Wee1 and Chk1/2 inhibitors in malignant melanoma.
26025928 nasopharyngeal carcinoma cells depend on CHK1 and WEE1 activity for growth
25732734 WEE1 is a valid target of the miR-17-92 cluster in leukemia.
25659151 identified the PI3K/Akt pathway, the cell-cycle regulator Wee1 kinase, and protein kinase C (PKC) as prospective regulatory nodes of neuronal excitability through modulation of the FGF14:Nav1.6 complex.
25649652 This study showed that WEE1 (rs10770042; coding) associated with Alzheimer disease.
25428911 Report strong synergism observed by combining Chk1 and Wee1 inhibitors in preclinical models of mantle cell lymphoma.
More...

AA Sequence

MSFLSRQQPPPPRRAGAACTLRQKLIFSPCSDCEEEEEEEEEEGSGHSTGEDSAFQEPDSPLPPARSPTE      1 - 70
PGPERRRSPGPAPGSPGELEEDLLLPGACPGADEAGGGAEGDSWEEEGFGSSSPVKSPAAPYFLGSSFSP     71 - 140
VRCGGPGDASPRGCGARRAGEGRRSPRPDHPGTPPHKTFRKLRLFDTPHTPKSLLSKARGIDSSSVKLRG    141 - 210
SSLFMDTEKSGKREFDVRQTPQVNINPFTPDSLLLHSSGQCRRRKRTYWNDSCGEDMEASDYELEDETRP    211 - 280
AKRITITESNMKSRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAH    281 - 350
AVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSM    351 - 420
SLVHMDIKPSNIFISRTSIPNAASEEGDEDDWASNKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQE    421 - 490
NYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSA    491 - 560
MALVKHSVLLSASRKSAEQLRIELNAEKFKNSLLQKELKKAQMAKAAAEERALFTDRMATRSTTQSNRTS    561 - 630
RLIGKKMNRSVSLTIY                                                          631 - 646
//

Text Mined References (108)

PMID Year Title
26645158 2015 Targeting of Carbon Ion-Induced G2 Checkpoint Activation in Lung Cancer Cells Using Wee-1 Inhibitor MK-1775.
26602815 2015 Inhibiting WEE1 Selectively Kills Histone H3K36me3-Deficient Cancers by dNTP Starvation.
26598692 2015 A haploid genetic screen identifies the G1/S regulatory machinery as a determinant of Wee1 inhibitor sensitivity.
26431163 2015 Mdm2 inhibition confers protection of p53-proficient cells from the cytotoxic effects of Wee1 inhibitors.
26054341 2015 Combined inhibition of the cell cycle related proteins Wee1 and Chk1/2 induces synergistic anti-cancer effect in melanoma.
26025928 2015 Pharmacological inactivation of CHK1 and WEE1 induces mitotic catastrophe in nasopharyngeal carcinoma cells.
25732734 2015 WEE1 is a validated target of the microRNA miR-17-92 cluster in leukemia.
25659151 2015 Identifying a kinase network regulating FGF14:Nav1.6 complex assembly using split-luciferase complementation.
25649652 2015 Linking Genetics of Brain Changes to Alzheimer's Disease: Sparse Whole Genome Association Scan of Regional MRI Volumes in the ADNI and AddNeuroMed Cohorts.
25428911 2015 Combined inhibition of Chk1 and Wee1 as a new therapeutic strategy for mantle cell lymphoma.
More...