Property Summary

NCBI Gene PubMed Count 146
Grant Count 146
R01 Count 90
Funding $14,276,368.52
PubMed Score 299.62
PubTator Score 253.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.049 0.034
medulloblastoma, large-cell -1.300 0.000
non-small cell lung cancer -1.408 0.000
lung cancer -3.300 0.000
lung adenocarcinoma -1.400 0.000
ovarian cancer 1.300 0.000

Synonym

Gene

PDB

3G33  

Gene RIF (95)

PMID Text
26055066 cyclin-D1 and cyclin-D3 within human islet cells varies according to the status of the pancreas donor
26026083 G1 arrest induced by SB265610 occurred at concentrations lacking CXCR2 selectivity and revealed cyclin-dependent kinase 2 (CDK2) (Thr160) hypophosphorylation, cyclin D3 gene down-regulation, and p21 post-translational induction
25927932 The CDK6-cyclin D3 pair play a fundamental role in controlling CDK2-dependent SAMHD1 phosphorylation and the dNTP pool in primary macrophages.
25704763 HIV-1 MA natural variant S75X upregulates the expression of two cyclins D2 and D3, and induces significant release of cytokine IL-6, which leads to enhance proliferation of both Epstein-Barr virus (EBV)-infected primary and fully transformed B-lymphocytes
25439221 combined expression of miR-138 and its direct target CCND3 may be correlated with significant characteristics of hepatocellular carcinoma
25300797 Two recurrent fusion genes associated with the 12q locus, LRP1-SNRNP25 and KCNMB4-CCND3, were by RT-PCR, Sanger sequencing and FISH, and were found to be osteosarcoma specific in a validation cohort of 240 other sarcomas.
25160985 Namely the amplification of the expression of the PLCB1a, but not of PLCB1b, is able to maintain high levels of expression of cyclin D3 even after treatment with kinamycin F
24441043 sLZIP regulates the transcription of cyclin D3 by binding directly to the AP-1 region in the cyclin D3 promoter.
23967867 two cell cycle-related molecules, cyclin D3 and E2F3, were identified as the direct miR-503 targets.
23963898 cell cycle related proteins PCNA, Ki67, cyclin D3, p27 and p57 were expressed in both normal and diabetic human term placentas.
More...

AA Sequence

MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEE      1 - 70
QRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDW     71 - 140
EVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGA    141 - 210
AVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQ    211 - 280
TSTPTDVTAIHL                                                              281 - 292
//

Text Mined References (152)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26055066 2015 The subcellular distribution of cyclin-D1 and cyclin-D3 within human islet cells varies according to the status of the pancreas donor.
26026083 2015 Induction of G1 Arrest by SB265610 Involves Cyclin D3 Down-regulation and Suppression of CDK2 (Thr160) Phosphorylation.
25927932 2015 Cyclin D3-dependent control of the dNTP pool and HIV-1 replication in human macrophages.
25439221 2015 Clinical significance of microRNA 138 and cyclin D3 in hepatocellular carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25300797 2014 Recurrent LRP1-SNRNP25 and KCNMB4-CCND3 fusion genes promote tumor cell motility in human osteosarcoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25160985 2015 PLC?1a and PLC?1b selective regulation and cyclin D3 modulation reduced by kinamycin F during k562 cell differentiation.
More...