Property Summary

Ligand Count 1
NCBI Gene PubMed Count 155
PubMed Score 308.38
PubTator Score 253.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma -1.400 2.5e-09
lung cancer -1.600 4.0e-02
medulloblastoma, large-cell -1.300 1.1e-04
non-small cell lung cancer -1.408 1.8e-21
osteosarcoma -1.049 3.4e-02
ovarian cancer -1.100 9.3e-05

Gene RIF (102)

AA Sequence

MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEE      1 - 70
QRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDW     71 - 140
EVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGA    141 - 210
AVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQ    211 - 280
TSTPTDVTAIHL                                                              281 - 292
//

Text Mined References (161)

PMID Year Title