Property Summary

NCBI Gene PubMed Count 161
PubMed Score 401.39
PubTator Score 287.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Mental Depression 333 0.0 0.9
Peripheral vascular disease 87 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 5.256 2.6

Expression

  Differential Expression (35)

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (112)

AA Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQ      1 - 70
KCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWE     71 - 140
LVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAA    141 - 210
ICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQAST    211 - 280
PTDVRDIDL                                                                 281 - 289
//

Text Mined References (163)

PMID Year Title