Property Summary

NCBI Gene PubMed Count 147
Grant Count 223
R01 Count 133
Funding $16,973,073.24
PubMed Score 381.13
PubTator Score 287.39

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P30279 A8K531 Q13955 Q5U035
Symbols MPPH3
KIAK0002

Gene

 GO Function (1)

Gene RIF (101)

PMID Text
26707908 this study shows that miR-124-3p may negatively regulate the transcription of the STAT3 by interfering with its 3'UTR, and the degradation of STAT3 affects its downstream expression of such as p-STAT3, CCND2 and MMP-2
26341922 these results highlight the impact of CCND2 3'UTR shortening on miRNA-dependent regulation of CCND2 in multiple myeloma.
26290144 The results do not support our hypothesis that common germline genetic variants in the CCND2 genes is associated with the risk of developing medulloblastoma.
26225959 miR-198 inhibited HaCaT cell proliferation by directly targeting CCND2.
26221902 Up-regulation of clyclinD2 regulates laryngeal squamous cell carcinoma cell growth.
25980436 CCND2 was identified as a putative target gene for SMYD3 transcriptional regulation, through trimethylation of H4K20.Our results support a proto-oncogenic role for SMYD3 in prostate carcinogenesis, mainly due to its methyltransferase enzymatic activity.
25961636 Treatment of rSCC-61 and SCC-61 with the DNA hypomethylating agent 5-aza-2'deoxycitidine increased CCND2 levels only in rSCC-61 cells, while treatment with the control reagent cytosine arabinoside did not influence the expression of this gene
25960238 the dysregulation of miR-206-CCND2 axis may contribute to the aggressive progression and poor prognosis of human gastric cancer.
25824739 Cyclin D2 hypermethylation is associated with breast cancer.
25817794 that re-introducing CDK6, cyclin-D1 or cyclin-D2 expression partially, but significantly, rescues cells from the suppression of cell proliferation and cell cycle arrest mediated by miR-340
More...

AA Sequence

MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQ      1 - 70
KCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWE     71 - 140
LVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAA    141 - 210
ICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQAST    211 - 280
PTDVRDIDL                                                                 281 - 289
//

Text Mined References (150)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26707908 2016 MicroRNA-124-3p inhibits the growth and metastasis of nasopharyngeal carcinoma cells by targeting STAT3.
26341922 2016 Post-transcriptional Modifications Contribute to the Upregulation of Cyclin D2 in Multiple Myeloma.
26290144 2015 CCND2, CTNNB1, DDX3X, GLI2, SMARCA4, MYC, MYCN, PTCH1, TP53, and MLL2 gene variants and risk of childhood medulloblastoma.
26225959 2015 miR-198 Represses the Proliferation of HaCaT Cells by Targeting Cyclin D2.
26221902 2015 miR-206 inhibits human laryngeal squamous cell carcinoma cell growth by regulation of cyclinD2.
25980436 2015 SMYD3 contributes to a more aggressive phenotype of prostate cancer and targets Cyclin D2 through H4K20me3.
25961636 2015 Analysis of DNA methylation and gene expression in radiation-resistant head and neck tumors.
25960238 2015 Prognostic significance of combined microRNA-206 and CyclinD2 in gastric cancer patients after curative surgery: A retrospective cohort study.
25824739 2015 Loss of expression of cyclin d2 by aberrant DNA methylation: a potential biomarker in vietnamese breast cancer patients.
More...