Property Summary

NCBI Gene PubMed Count 47
Grant Count 8
R01 Count 4
Funding $508,230.33
PubMed Score 88.63
PubTator Score 103.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
25513989 Data indicate that the decreasing trend in the expression level of TCRzeta chain, ZAP-70 kinase and epsilon Fc Receptors FcvarepsilonRIgamma was significantly associated with disease progression.
24023253 Studies indicate that in response to stimulation with antigen, PHB1 translocated to plasma membrane lipid rafts to form a ternary complex with the high-affinity IgE receptor FcepsilonRIgamma and the nonreceptor tyrosine kinase Syk.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of high affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) expression by HIV-1 Vpr in Vpr transduced macrophages
23228155 High expression of FCER1G is associated with chronic myeloid leukemia.
22706086 CD2-associated adaptor protein (CD2AP) positively regulates blood dendritic cell antigen 2 (BDCA2)/FcepsilonR1gamma signaling by forming a complex with SH2 domain-containing inositol 5'-phosphatase (SHIP)1 to inhibit the E3 ubiquitin ligase Cbl.
22664044 There was loss of the negative correlation in the expression levels of CD3eta and FcepsilonRIgamma genes in CLL patients.
22401598 Altered expression of the TCR signaling related genes CD3 and FcepsilonRIgamma in patients with aplastic anemia.
22150093 Demethylation of specific regulatory elements within the FCER1G locus contributes to FcepsilonRI overexpression on monocytes from patients with atopic dermatitis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST      1 - 70
RNQETYETLKHEKPPQ                                                           71 - 86
//

Text Mined References (52)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25513989 2015 Characteristics of TCR?, ZAP-70, and Fc?RI? gene expression in patients with T- and NK/T-cell lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023253 2013 A role for prohibitin in mast cell activation: location matters.
23228155 2012 Alternative expression of TCR? related genes in patients with chronic myeloid leukemia.
22706086 2012 CD2AP/SHIP1 complex positively regulates plasmacytoid dendritic cell receptor signaling by inhibiting the E3 ubiquitin ligase Cbl.
22664044 2012 Expression feature of CD3, Fc?RI?, and Zap-70 in patients with chronic lymphocytic leukemia.
22401598 2012 Altered expression of the TCR signaling related genes CD3 and Fc?RI? in patients with aplastic anemia.
22150093 2012 Demethylation of the FCER1G promoter leads to Fc?RI overexpression on monocytes of patients with atopic dermatitis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...