Property Summary

NCBI Gene PubMed Count 52
PubMed Score 91.32
PubTator Score 103.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (30)

Gene RIF (30)

AA Sequence

MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLST      1 - 70
RNQETYETLKHEKPPQ                                                           71 - 86
//

Text Mined References (57)

PMID Year Title