Property Summary

NCBI Gene PubMed Count 86
PubMed Score 84.82
PubTator Score 58.83

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
active Crohn's disease 1.145 6.1e-03
atypical teratoid / rhabdoid tumor -2.100 4.4e-06
glioblastoma -2.000 6.3e-04
lung cancer 1.200 6.2e-04
medulloblastoma -1.600 4.4e-04
medulloblastoma, large-cell -2.200 3.3e-06
osteosarcoma -1.905 9.0e-05
ovarian cancer 2.000 8.0e-05
psoriasis -1.900 3.2e-03
ulcerative colitis 1.100 9.3e-06

Synonym

Accession P30260 G3V1C4 Q16349 Q96F35
Symbols APC3
HNUC
NUC2
H-NUC
ANAPC3
CDC27Hs
D0S1430E
D17S978E

Gene

PDB

4UI9   5A31   5G04   5G05   5KHR   5KHU   5L9T   5L9U   5LCW   3T1N   4RG6   4RG9   4RG7  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (16)

AA Sequence

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQ      1 - 70
CKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQK     71 - 140
SLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTI    141 - 210
ELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTP    211 - 280
SFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQ    281 - 350
SSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ    351 - 420
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSH    421 - 490
LPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT    491 - 560
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRV    561 - 630
NPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDP    631 - 700
KNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKG    701 - 770
ANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF                    771 - 824
//

Text Mined References (97)

PMID Year Title