Property Summary

NCBI Gene PubMed Count 74
Grant Count 40
R01 Count 26
Funding $4,140,003.15
PubMed Score 84.65
PubTator Score 58.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.900 0.003
osteosarcoma -1.905 0.000
atypical teratoid / rhabdoid tumor -2.100 0.000
glioblastoma -2.000 0.001
medulloblastoma -1.600 0.000
medulloblastoma, large-cell -2.200 0.000
lung cancer 1.200 0.001
active Crohn's disease 1.145 0.006
ulcerative colitis 1.100 0.000
ovarian cancer 2.000 0.000

 GO Function (1)

Gene RIF (14)

PMID Text
26882976 Cdc27 is a novel binding partner of Elmo1.Cdc27-Elmo1 has a cellular role independent from the Elmo-Dock1-Rac signal module.
25943633 miR-27a could modulate proliferation and radiosensitivity of TNBC cells. CDC-27 is a direct target of miR-27a and its downregulation conferred increased radioresistance of the cells.
25680405 These findings suggested that polymorphisms in cdc27 may contribute to the susceptibility of BC though functional studies are needed to further elucidate the underling mechanisms of the associations
25490258 The structures show how one APC16 binds asymmetrically to the symmetric APC3 dimer and, together with biochemistry and prior data, explain how APC16 recruits APC7 to APC3.
23923534 Down-regulation of CDC27 protein is associated with radiation resistance.
23755904 Low cdc27 and high securin expression predict short survival for breast cancer patients.
23078409 Data indicate that additional density present in the anaphase-promoting complex (APC/C) structure, proximal to Apc3/Cdc27 of the (tetratricopeptide repeat) lobe, is assigned to the TPR subunit Apc7, a subunit specific to vertebrate APC/C.
22139841 the biochemical, structural, and cellular determinants of the novel interaction between MCPH1 and Cdc27 and suggest that this interaction may occur within the larger context of MCPH1-APC/C.
21336306 Cdc20 requires APC3 and APC8 to bind and activate the APC/C when the spindle assembly checkpoint is satisfied, but only APC8 when active, and APC10 is crucial for the destruction of cyclin B1 and securin, but not cyclin A
21209074 phosphorylation of Cdc27 by CKII is involved in TGF-beta-induced activation of APC.
More...

AA Sequence

MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRLLKGHSCTTPQ      1 - 70
CKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSLLGHVYCKTDRLAKGSECYQK     71 - 140
SLSLNPFLWSPFESLCEIGEKPDPDQTFKFTSLQNFSNCLPNSCTTQVPNHSLSHRQPETVLTETPQDTI    141 - 210
ELNRLNLESSNSKYSLNTDSSVSYIDSAVISPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTP    211 - 280
SFGILPLETPSPGDGSYLQNYTNTPPVIDVPSTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPILAQTQ    281 - 350
SSGPQTSTTPQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGITQ    351 - 420
PNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSYNCKEAINILSH    421 - 490
LPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIYSTTLWHLQKDVALSVLSKDLT    491 - 560
DMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPNYAYAYTLLGHEFVLTEELDKALACFRNAIRV    561 - 630
NPRHYNAWYGLGMIYYKQEKFSLAEMHFQKALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDP    631 - 700
KNPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKG    701 - 770
ANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF                    771 - 824
//

Text Mined References (85)

PMID Year Title
26882976 2016 Identification of a novel protein interaction between Elmo1 and Cdc27.
25943633 2015 MiR-27a modulates radiosensitivity of triple-negative breast cancer (TNBC) cells by targeting CDC27.
25680405 2015 Association between polymorphisms in cdc27 and breast cancer in a Chinese population.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25490258 2015 Structure of an APC3-APC16 complex: insights into assembly of the anaphase-promoting complex/cyclosome.
25416956 2014 A proteome-scale map of the human interactome network.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
24781523 2014 PP2A delays APC/C-dependent degradation of separase-associated but not free securin.
24699064 2014 Discovery of biclonal origin and a novel oncogene SLC12A5 in colon cancer by single-cell sequencing.
24576404 2014 Identification of somatic mutations in EGFR/KRAS/ALK-negative lung adenocarcinoma in never-smokers.
More...