Property Summary

NCBI Gene PubMed Count 46
Grant Count 59
R01 Count 34
Funding $10,817,462.76
PubMed Score 1052.62
PubTator Score 521.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer -1.400 0.024
cutaneous lupus erythematosus 1.800 0.005
psoriasis 1.600 0.001
atypical teratoid / rhabdoid tumor 1.100 0.001
glioblastoma 1.100 0.009
medulloblastoma, large-cell 1.400 0.000
tuberculosis -1.100 0.000
interstitial cystitis 1.400 0.001
pancreatic carcinoma -1.400 0.024
ovarian cancer 1.800 0.000

Synonym

Accession P30203 A4KAD4 A4KAD5 Q9UMF2 Q9Y4K7 Q9Y4K8 Q9Y4K9 Q9Y4L0
Symbols TP120

Gene

CD6

PANTHER Protein Class (3)

PDB

5A2E  

Gene RIF (29)

PMID Text
26146185 The binding sites on CD6 and CD166 have been characterized to show that a SNP in CD6 causes glycosylation that hinders the CD6/CD166 interaction.
25088497 CD6 regulatory T cells are characterized by CD6 expression and FOXP3 expression.
24945728 interaction of Galectin-1 and -3 with CD6
24890719 upon T cell activation, SRSF1 becomes limiting, and its function in CD6 exon 5 splicing is countered by an increase in CD6 transcription, dependent on chromatin acetylation.
24130718 The CD6 polymorphism conferred reduced odds of optic neuritis as an attack location
23711376 A novel level of regulation of CD6 function by intracytoplasmic serine phosphorylation.
23638056 Our findings reveal that this new MS-associated CD6 risk haplotype significantly modifies expression of CD6 on CD4(+) and CD8(+) T cells.
22994200 In a Korean population, one SNP in CD6 was associated with neuromyelitis optica.
22685579 Data suggest that genetic variations within CD6 and syntaxin binding protein 6 (STXBP6) may influence response to TNFalpha inhibitors in patients with rheumatoid arthritis (RA).
21956609 Cd6 is a signaling attenuator whose expression alone, i.e. in the absence of ligand engagement, is sufficient to restrain signaling in T cells.
More...

AA Sequence

MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPAC      1 - 70
GALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVV     71 - 140
EHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQA    141 - 210
LPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEV    211 - 280
HFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLC    281 - 350
SQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA    351 - 420
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYD    421 - 490
FSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRS    491 - 560
NSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQ    561 - 630
NFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA                                    631 - 668
//

Text Mined References (48)

PMID Year Title
26146185 2015 Structures of CD6 and Its Ligand CD166 Give Insight into Their Interaction.
25088497 2014 Human treg cells are characterized by low/negative CD6 expression.
24945728 2014 Modulation of CD6 function through interaction with Galectin-1 and -3.
24890719 2014 T cell activation regulates CD6 alternative splicing by transcription dynamics and SRSF1.
24584089 2014 Quantitative proteomics analysis of signalosome dynamics in primary T cells identifies the surface receptor CD6 as a Lat adaptor-independent TCR signaling hub.
24130718 2013 Association of multiple sclerosis susceptibility variants and early attack location in the CNS.
23711376 2013 Identification of functionally relevant phoshorylatable serine clusters in the cytoplasmic region of the human CD6 lymphocyte surface receptor.
23638056 2013 Fine mapping and functional analysis of the multiple sclerosis risk gene CD6.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22994200 2013 Associations of CD6, TNFRSF1A and IRF8 polymorphisms with risk of inflammatory demyelinating diseases.
More...