Property Summary

NCBI Gene PubMed Count 53
PubMed Score 1124.27
PubTator Score 521.12

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.5e-03
cutaneous lupus erythematosus 1.800 4.8e-03
glioblastoma 1.100 8.8e-03
interstitial cystitis 1.300 1.0e-02
medulloblastoma, large-cell 1.400 5.2e-05
ovarian cancer 1.400 3.8e-11
pancreatic cancer -1.400 2.4e-02
pancreatic carcinoma -1.400 2.4e-02
psoriasis 1.600 6.7e-04
tuberculosis -1.100 1.9e-04

Gene RIF (35)

AA Sequence

MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPAC      1 - 70
GALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVV     71 - 140
EHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQA    141 - 210
LPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEV    211 - 280
HFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLC    281 - 350
SQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIA    351 - 420
FILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYD    421 - 490
FSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRS    491 - 560
NSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQ    561 - 630
NFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA                                    631 - 668
//

Text Mined References (54)

PMID Year Title