Property Summary

NCBI Gene PubMed Count 48
PubMed Score 16.87
PubTator Score 26.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
lung cancer -2.000 2.6e-03
adrenocortical carcinoma -1.031 2.4e-02
breast carcinoma -1.300 1.1e-02
ductal carcinoma in situ -1.100 7.5e-03
fibroadenoma -2.000 2.1e-02
glioblastoma 1.100 1.3e-03
intraductal papillary-mucinous carcinoma... -1.100 1.4e-02
invasive ductal carcinoma -2.300 8.3e-03
lung carcinoma 1.100 9.7e-22
malignant mesothelioma 1.100 1.0e-05
medulloblastoma, large-cell 1.100 2.0e-04
osteosarcoma -1.652 1.7e-03
pancreatic cancer -1.300 5.0e-03
pancreatic ductal adenocarcinoma liver m... -1.765 2.2e-03
pituitary cancer -1.200 2.8e-05

Gene RIF (27)

AA Sequence

MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT      1 - 70
IYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYF     71 - 140
VPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLEL    141 - 210
DSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFS    211 - 280
ELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTN    281 - 350
QHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI    351 - 420
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWA    421 - 490
QNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIG    491 - 560
PILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA                                 561 - 601
//

Text Mined References (56)

PMID Year Title