Property Summary

NCBI Gene PubMed Count 47
PubMed Score 17.07
PubTator Score 26.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.100 1.0e-05
osteosarcoma -1.652 1.7e-03
glioblastoma 1.100 1.3e-03
medulloblastoma, large-cell 1.100 2.0e-04
adrenocortical carcinoma -1.031 2.4e-02
pancreatic ductal adenocarcinoma liver m... -1.765 2.2e-03
intraductal papillary-mucinous carcinoma... -1.100 1.4e-02
lung cancer -2.000 2.6e-03
breast carcinoma -1.300 1.1e-02
fibroadenoma -2.000 2.1e-02
lung carcinoma 1.100 9.7e-22
ductal carcinoma in situ -3.000 4.5e-04
invasive ductal carcinoma -3.500 1.7e-03
pituitary cancer -1.200 2.8e-05
pancreatic cancer -1.300 5.0e-03

Gene RIF (27)

PMID Text
26247730 MicroRNA-587 antagonizes 5-fluorouracil-induced apoptosis and confers drug resistance by regulating PPP2R1B expression in colorectal cancer.
23588898 For PPP2R1B, no mutations were detected in our samples.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21420167 Data show that the only gene that was expressed, although not at high levels, in all the cells carrying the 11q23.1 amplification was PPP2R1B.
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20862322 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20689807 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20133745 Data show that PR65-dominated fluctuations of PP2A have the effect of opening and closing the enzyme's substrate binding/catalysis interface, as well as altering the positions of certain catalytic residues.
19951945 Data show that upon hypoxia, the TGF-beta-induced phosphorylation of Smad3 was inhibited, although Smad2 remained phosphorylated, and Smad3 was dephosphorylated by PP2A.
17676665 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
17540176 These observations identify PP2A Abeta as a tumor suppressor gene that transforms immortalized human cells by regulating the function of RalA.
17449237 PPP2R1B, together with NPAT and CUL5, is implicated in the deregulation of the cell-cycle and apoptosis regulators and in the pathogenesis of B-CLL.
17343570 Observational study of gene-disease association. (HuGE Navigator)
17343570 PPP2R1B genes may not play a role in the carcinogenesis of cervical cancer. Mutations of PPP2R1B gene are not frequent in cervical cancer.
17324501 These data suggest the possibility that aberrant transcripts of PPP2R1B might be associated with the development of HCC.
17266553 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
16276521 Observational study of gene-disease association. (HuGE Navigator)
15936019 Functional interaction between PR65, a regulatory subunit of the protein phosphatase 2A (PP2A), and CFTR was shown.
14767517 PPP2R1B has a role in regulating activity of specific downstream target proteins for cell cycle regulation in colorectal cancers
14576831 apoptosis mediated by Fas, TNF-alpha, and TRAIL in U937 cells is suppressed by calyculin A, an inhibitor of type-1 and type-2A protein phosphatases
11531413 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9400615 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
9013886 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells

AA Sequence

MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT      1 - 70
IYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYF     71 - 140
VPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLEL    141 - 210
DSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFS    211 - 280
ELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTN    281 - 350
QHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI    351 - 420
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWA    421 - 490
QNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIG    491 - 560
PILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA                                 561 - 601
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26247730 2015 MicroRNA-587 antagonizes 5-FU-induced apoptosis and confers drug resistance by regulating PPP2R1B expression in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23588898 2013 Infrequent mutations of the PPP2R1A and PPP2R1B genes in patients with ovarian cancer.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21420167 2011 Chromosome 11q23.1 is an unstable region in B-cell tumor cell lines.
21269460 2011 Initial characterization of the human central proteome.
21172653 2010 The dependence receptor UNC5H2/B triggers apoptosis via PP2A-mediated dephosphorylation of DAP kinase.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20133745 2010 PR65, the HEAT-repeat scaffold of phosphatase PP2A, is an elastic connector that links force and catalysis.
19951945 2010 Hypoxia-activated Smad3-specific dephosphorylation by PP2A.
19156129 2009 An integrated workflow for charting the human interaction proteome: insights into the PP2A system.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18715871 2008 PP4R4/KIAA1622 forms a novel stable cytosolic complex with phosphoprotein phosphatase 4.
17540176 2007 The tumor suppressor PP2A Abeta regulates the RalA GTPase.
17452356 2007 Non-EST-based prediction of novel alternatively spliced cassette exons with cell signaling function in Caenorhabditis elegans and human.
17449237 2007 Analysis of 11q22-q23 deletion target genes in B-cell chronic lymphocytic leukaemia: evidence for a pathogenic role of NPAT, CUL5, and PPP2R1B.
17343570 Mutation analysis of the tumor suppressor gene PPP2R1B in human cervical cancer.
17324501 2007 Alterations of tumour suppressor gene PPP2R1B in hepatocellular carcinoma.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16541025 2006 Shugoshin collaborates with protein phosphatase 2A to protect cohesin.
16456541 2006 B56-containing PP2A dephosphorylate ERK and their activity is controlled by the early gene IEX-1 and ERK.
16276521 2006 The glycine 90 to aspartate alteration in the Abeta subunit of PP2A (PPP2R1B) associates with breast cancer and causes a deficit in protein function.
15936019 2005 Interaction of the protein phosphatase 2A with the regulatory domain of the cystic fibrosis transmembrane conductance regulator channel.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14767517 2004 PPP2R1B gene alterations inhibit interaction of PP2A-Abeta and PP2A-C proteins in colorectal cancers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576831 2003 Type-2A protein phosphatase activity is required to maintain death receptor responsiveness.
12912990 2003 Cytosolic Arl2 is complexed with cofactor D and protein phosphatase 2A.
12670497 2003 Interaction between protein phosphatase 2A and members of the importin beta superfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11996789 2002 Alterations in the suppressor gene PPP2R1B in parathyroid hyperplasias and adenomas.
11929880 2002 Protein phosphatase 2A holoenzyme assembly: identification of contacts between B-family regulatory and scaffolding A subunits.
11591705 2001 Protein phosphatase 2A interacts with and directly dephosphorylates RelA.
11531413 2001 HIV-1 Vpr induces cell cycle G2 arrest in fission yeast (Schizosaccharomyces pombe) through a pathway involving regulatory and catalytic subunits of PP2A and acting on both Wee1 and Cdc25.
11440634 2001 Involvement of protein phosphatase 2A in the interleukin-3-stimulated Jak2-Stat5 signaling pathway.
11313745 2001 A high-resolution integrated map spanning the SDHD gene at 11q23: a 1.1-Mb BAC contig, a partial transcript map and 15 new repeat polymorphisms in a tumour-suppressor region.
11007961 2000 Type 2A protein phosphatase, the complex regulator of numerous signaling pathways.
10896920 2000 Alterations of the PPP2R1B gene located at 11q23 in human colorectal cancers.
10801873 2000 Raf-1-associated protein phosphatase 2A as a positive regulator of kinase activation.
10597236 1999 Absence of PPP2R1B gene alterations in primary ovarian cancers.
10358086 1999 Characterization of a novel giant scaffolding protein, CG-NAP, that anchors multiple signaling enzymes to centrosome and the golgi apparatus.
9795170 1998 Genomic organization and precise physical location of protein phosphatase 2A regulatory subunit A beta isoform gene on chromosome band 11q23.
9765152 1998 Alterations of the PPP2R1B gene in human lung and colon cancer.
9400615 1997 Increasing the ratio of PP2A core enzyme to holoenzyme inhibits Tat-stimulated HIV-1 transcription and virus production.
9353299 1997 HRX leukemic fusion proteins form a heterocomplex with the leukemia-associated protein SET and protein phosphatase 2A.
9013886 1997 Direct activation of protein phosphatase-2A0 by HIV-1 encoded protein complex NCp7:vpr.
8392071 1993 Structure and expression of a 72-kDa regulatory subunit of protein phosphatase 2A. Evidence for different size forms produced by alternative splicing.
2159327 1990 alpha- and beta-forms of the 65-kDa subunit of protein phosphatase 2A have a similar 39 amino acid repeating structure.
1328247 1992 Expression of the A subunit of protein phosphatase 2A and characterization of its interactions with the catalytic and regulatory subunits.