Property Summary

NCBI Gene PubMed Count 47
PubMed Score 17.07
PubTator Score 26.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Carcinoma of lung 5
Lung Neoplasms 171
Disease Target Count P-value
lung carcinoma 2844 9.69270160419001E-22
malignant mesothelioma 3163 1.03124690670732E-5
pituitary cancer 1972 2.75127630382114E-5
medulloblastoma, large-cell 6234 1.97856620858935E-4
ductal carcinoma in situ 1745 4.46824888519969E-4
glioblastoma 5572 0.00130317388155535
invasive ductal carcinoma 2950 0.00168289593708001
osteosarcoma 7933 0.00172434140015577
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00218018894956933
pancreatic cancer 2300 0.00498894213322943
breast carcinoma 1614 0.0109798860861247
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0143720093991075
fibroadenoma 557 0.0211473676128573
adrenocortical carcinoma 1427 0.0240123485650882
Disease Target Count
lung cancer 4473

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.652 0.002
glioblastoma 1.100 0.001
medulloblastoma, large-cell 1.100 0.000
adrenocortical carcinoma -1.031 0.024
pancreatic ductal adenocarcinoma liver m... -1.765 0.002
intraductal papillary-mucinous carcinoma... -1.100 0.014
lung cancer -2.000 0.003
breast carcinoma -1.300 0.011
fibroadenoma -2.000 0.021
lung carcinoma 1.100 0.000
ductal carcinoma in situ -3.000 0.000
invasive ductal carcinoma -3.500 0.002
pituitary cancer -1.200 0.000
pancreatic cancer -1.300 0.005

Synonym

Accession P30154 A8MY67 B0YJ69 B4DGQ6 B4DK91 B4DWW5 F8W8G1 O75620 Q8NHV8
Symbols PR65B
PP2A-Abeta

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (27)

PMID Text
26247730 MicroRNA-587 antagonizes 5-fluorouracil-induced apoptosis and confers drug resistance by regulating PPP2R1B expression in colorectal cancer.
23588898 For PPP2R1B, no mutations were detected in our samples.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21420167 Data show that the only gene that was expressed, although not at high levels, in all the cells carrying the 11q23.1 amplification was PPP2R1B.
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20862322 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20689807 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT      1 - 70
IYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYF     71 - 140
VPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLEL    141 - 210
DSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFS    211 - 280
ELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTN    281 - 350
QHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI    351 - 420
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWA    421 - 490
QNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIG    491 - 560
PILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA                                 561 - 601
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26247730 2015 MicroRNA-587 antagonizes 5-FU-induced apoptosis and confers drug resistance by regulating PPP2R1B expression in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23588898 2013 Infrequent mutations of the PPP2R1A and PPP2R1B genes in patients with ovarian cancer.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21420167 2011 Chromosome 11q23.1 is an unstable region in B-cell tumor cell lines.
21269460 2011 Initial characterization of the human central proteome.
21172653 2010 The dependence receptor UNC5H2/B triggers apoptosis via PP2A-mediated dephosphorylation of DAP kinase.
More...