Property Summary

NCBI Gene PubMed Count 47
Grant Count 1
Funding $28,570.33
PubMed Score 17.07
PubTator Score 26.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.652 0.002
glioblastoma 1.100 0.001
medulloblastoma, large-cell 1.100 0.000
adrenocortical carcinoma -1.031 0.024
pancreatic ductal adenocarcinoma liver m... -1.765 0.002
intraductal papillary-mucinous carcinoma... -1.100 0.014
lung cancer -2.000 0.003
breast carcinoma -1.300 0.011
fibroadenoma -2.000 0.021
lung carcinoma 1.100 0.000
ductal carcinoma in situ -3.000 0.000
invasive ductal carcinoma -3.500 0.002
pituitary cancer -1.200 0.000
pancreatic cancer -1.300 0.005

Synonym

Accession P30154 A8MY67 B0YJ69 B4DGQ6 B4DK91 B4DWW5 F8W8G1 O75620 Q8NHV8
Symbols PR65B
PP2A-Abeta

Gene

 Grant Application (1)

Gene RIF (28)

PMID Text
26247730 MicroRNA-587 antagonizes 5-fluorouracil-induced apoptosis and confers drug resistance by regulating PPP2R1B expression in colorectal cancer.
23588898 For PPP2R1B, no mutations were detected in our samples.
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21420167 Data show that the only gene that was expressed, although not at high levels, in all the cells carrying the 11q23.1 amplification was PPP2R1B.
21351466 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
21072166 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20862322 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
20689807 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT      1 - 70
IYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKAVESLRQISQEHTPVALEAYF     71 - 140
VPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQQFRSLCSDDTPMVRRAAASKLGEFAKVLEL    141 - 210
DSVKSEIVPLFTSLASDEQDSVRLLAVEACVSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFS    211 - 280
ELQKAMGPKITLNDLIPAFQNLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTN    281 - 350
QHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI    351 - 420
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGTEWA    421 - 490
QNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIG    491 - 560
PILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLALA                                 561 - 601
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26247730 2015 MicroRNA-587 antagonizes 5-FU-induced apoptosis and confers drug resistance by regulating PPP2R1B expression in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23588898 2013 Infrequent mutations of the PPP2R1A and PPP2R1B genes in patients with ovarian cancer.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21420167 2011 Chromosome 11q23.1 is an unstable region in B-cell tumor cell lines.
21269460 2011 Initial characterization of the human central proteome.
21172653 2010 The dependence receptor UNC5H2/B triggers apoptosis via PP2A-mediated dephosphorylation of DAP kinase.
More...