Property Summary

NCBI Gene PubMed Count 86
PubMed Score 25.31
PubTator Score 31.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.027

Synonym

Accession P30153 Q13773 Q6ICQ3 Q96DH3
Symbols MRD36
PR65A
PP2AAALPHA
PP2A-Aalpha

Gene

PDB

3C5W   4I5L   4I5N   3DW8   4LAC   2NPP   2NYL   2NYM   2IE3   2IE4   3K7V   3K7W   1B3U   2PKG  

Gene RIF (39)

PMID Text
24885237 Our results suggest that IH-induced ROS generation increases PP2A activation and subsequently downregulates ERK1/2 activation, which results in inhibition of PC12 cell proliferation through G0/G1 phase arrest and NGF-induced neuronal differentiation.
24465463 PR65A phosphorylation regulates PP2A complex signaling.
24204789 The two functional variants in PPP2R1A and PPP2R5E and their combinations are associated with lung cancer risk in the Chinese.
24120762 Partial unfolding of PR65/A impacts catalysis by altering the proximity of bound catalytic subunit and substrate.
23588898 For PPP2R1A, a heterozygous, somatic mutation (c.771G>T, p.W257C) was identified in 1 out of 37 patients (2.7%) with primary ovarian endometrioid carcinoma.
23555712 gene transcription of PPP2R1A regulated by the polymorphism and methylation in the promoter region
23287597 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
23267135 This study indicates that the PPP2R1A mutation occurs at a lower frequency compared to other gynecological malignancies, irrespective of the histological subtype
23047923 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
22422068 HIV-1 Tat upregulates the total levels of PP2A protein and downregulates the inactive form of phosphorylated PP2A, which leads to inhibit hTERT activity directly or indirectly in CD4+ T cells
More...

AA Sequence

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALA      1 - 70
EQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDW     71 - 140
FTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFS    141 - 210
NLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITK    211 - 280
TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIM    281 - 350
GLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR    351 - 420
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMS    421 - 490
GDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEV    491 - 560
KPILEKLTQDQDVDVKYFAQEALTVLSLA                                             561 - 589
//

Text Mined References (96)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26168268 2015 B56?-related protein phosphatase 2A dysfunction identified in patients with intellectual disability.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25533962 2015 Large-scale discovery of novel genetic causes of developmental disorders.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24885237 2014 Intermittent hypoxia-induced protein phosphatase 2A activation reduces PC12 cell proliferation and differentiation.
24465463 2014 PR65A phosphorylation regulates PP2A complex signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204789 2013 Functional genetic polymorphisms in PP2A subunit genes confer increased risks of lung cancer in southern and eastern Chinese.
More...