Property Summary

NCBI Gene PubMed Count 145
PubMed Score 307.68
PubTator Score 212.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
active Crohn's disease 1.128 1.4e-02
acute quadriplegic myopathy 1.365 2.5e-06
astrocytic glioma -1.300 1.1e-02
Duchenne muscular dystrophy 1.087 4.2e-08
ependymoma 1.400 9.5e-13
glioblastoma 1.500 7.5e-03
intraductal papillary-mucinous adenoma (... 1.200 8.3e-04
intraductal papillary-mucinous carcinoma... 1.600 7.4e-04
juvenile dermatomyositis 1.633 1.5e-13
lung adenocarcinoma 2.001 2.7e-10
Multiple myeloma 1.233 1.8e-02
osteosarcoma -1.128 1.9e-03
ovarian cancer 3.200 2.1e-05
pancreatic ductal adenocarcinoma liver m... -2.381 9.0e-03

Protein-protein Interaction (2)

Gene RIF (109)

AA Sequence

MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA      1 - 70
ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR     71 - 140
TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH    141 - 210
LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR    211 - 280
NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE    281 - 350
RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG    351 - 420
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI    421 - 490
QEEKPKKKKKAQEDL                                                           491 - 505
//

Text Mined References (154)

PMID Year Title