Property Summary

NCBI Gene PubMed Count 136
Grant Count 82
R01 Count 60
Funding $4,909,173.27
PubMed Score 296.85
PubTator Score 212.80

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P30101 Q13453 Q14255 Q8IYF8 Q9UMU7
Symbols P58
ER60
ERp57
ERp60
ERp61
GRP57
GRP58
PI-PLC
HsT17083
HEL-S-269
HEL-S-93n

Gene

PDB

3F8U   2ALB   2DMM   2H8L  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652266 other 0 / 0 / 12 Selectivity Screen to determine compound activity against other thiol isomerases: ERp57 Measured in Biochemical System Using Plate Reader - 2137-09_Inhibitor_Dose_DryPowder_Activity

Gene RIF (102)

PMID Text
26869642 Amyotrophic lateral sclerosis-linked PDIA3 mutations disrupt motor neuron connectivity.
26772958 These data indicate that the presence of autoantibodies to PDIA3 favors the development of an efficient and specific T-cell response against PDIA3 in colorectal cancer patients.
26771192 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer
26724776 it is possible that the vimentin and PDIA3 could be the candidate biomarkers specific to Achyranthes saponin therapy for rheumatoid arthritis in synovial membrane.
26435004 ERp57 levels are increased in the airway epithelium of asthmatic patients and in mice with allergic airways disease.
26402295 Data suggest that regulation of PDIA3 (protein disulfide isomerase associated 3 protein) expression by microRNA-330-5p is important in maintaining hair cycle through regulation of proliferation and migration capability of keratinocytes.
26361352 ERp57 specifically contributes to peripheral nerve regeneration, whereas its activity is dispensable for the survival of a specific neuronal population of the central nervous system.
26214517 results suggested that ER chaperone PDIA3 plays a pivotal role in FFA-induced hepatocyte steatosis and apoptosis.
26170458 study identifies ERp57 as a new modulator of PrP levels and may help with understanding the consequences of ERp57 up-regulation observed in human disease
26125904 PDIA3 and PDIA6 gene expression is a neoplasm aggressiveness marker in primary ductal breast cancer.
More...

AA Sequence

MRLRRLALFPGVALLLAAARLAAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAA      1 - 70
ATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR     71 - 140
TEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSH    141 - 210
LTNKFEDKTVAYTEQKMTSGKIKKFIQENIFGICPHMTEDNKDLIQGKDLLIAYYDVDYEKNAKGSNYWR    211 - 280
NRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGEKFVMQEEFSRDGKALE    281 - 350
RFLQDYFDGNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG    351 - 420
EKLSKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQREATNPPVI    421 - 490
QEEKPKKKKKAQEDL                                                           491 - 505
//

Text Mined References (146)

PMID Year Title
26869642 2016 ALS-linked protein disulfide isomerase variants cause motor dysfunction.
26772958 2016 Protein disulfide isomerase A3-specific Th1 effector cells infiltrate colon cancer tissue of patients with circulating anti-protein disulfide isomerase A3 autoantibodies.
26771192 2016 LEDGF/p75 Overexpression Attenuates Oxidative Stress-Induced Necrosis and Upregulates the Oxidoreductase ERP57/PDIA3/GRP58 in Prostate Cancer.
26724776 2016 Identification of candidate synovial membrane biomarkers after Achyranthes aspera treatment for rheumatoid arthritis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26435004 2016 Protein disulfide isomerase-endoplasmic reticulum resident protein 57 regulates allergen-induced airways inflammation, fibrosis, and hyperresponsiveness.
26402295 2015 miR-330-5p inhibits proliferation and migration of keratinocytes by targeting Pdia3 expression.
26361352 2015 Functional Role of the Disulfide Isomerase ERp57 in Axonal Regeneration.
26214517 2015 PDIA3 Knockdown Exacerbates Free Fatty Acid-Induced Hepatocyte Steatosis and Apoptosis.
26170458 2015 The Protein-disulfide Isomerase ERp57 Regulates the Steady-state Levels of the Prion Protein.
More...