Property Summary

NCBI Gene PubMed Count 199
PubMed Score 484.30
PubTator Score 383.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.100 1.5e-02
atypical teratoid / rhabdoid tumor -1.200 1.1e-08
Chronic Lymphocytic Leukemia 1.312 1.2e-03
interstitial cystitis -1.100 2.9e-04
intraductal papillary-mucinous carcinoma... -1.500 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.300 2.6e-03
lung cancer 1.300 1.8e-03
Multiple myeloma 1.127 1.4e-03
ovarian cancer 1.700 9.0e-05
pancreatic ductal adenocarcinoma liver m... -2.028 8.3e-03
psoriasis -1.100 1.8e-04

 MGI Phenotype (1)

Gene RIF (163)

AA Sequence

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTD      1 - 70
PDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSN     71 - 140
RSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK                           141 - 187
//

Text Mined References (209)

PMID Year Title