Property Summary

NCBI Gene PubMed Count 186
Grant Count 73
R01 Count 47
Funding $9,104,838.48
PubMed Score 456.79
PubTator Score 383.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P30086 B2R4S1 PEBP-1
Symbols PBP
HCNP
PEBP
RKIP
HCNPpp
PEBP-1
HEL-210
HEL-S-34
HEL-S-96

Gene

PDB

1BD9   1BEH   2L7W   2QYQ  

Gene RIF (150)

PMID Text
26859895 report of the expression profile of RKIP in a heterogeneous group of soft tissue sarcomas; findings showed that only a small subset of cases exhibited RKIP loss, yet its loss is an independent biomarker of prognosis
26823735 RKIP inhibits glioma cell migration and invasivess by inhibiting MMP2/MMP9/HMAG2 expression.
26716415 Loss of RKIP is associated with neoplasms.
26617724 Downregulation or depletion of RKIP was related to the onset and progression of esophageal squamous cell carcinoma, and facilitated the invasion and metastasis of ESCC by downregulating E-cadherin and upregulating NF-kB p65.
26558823 Identify intestinal RKIP as capable of hydrolyzing prasugrel to its thiolactone metabolite.
26479924 RKIP is upregulated in heart failure.
26308852 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13
26238785 In triple negative breast cancer, RKIP regulates tumor-associated macrophage recruitment by blocking HMGA2, resulting in reduced expression of numerous macrophage chemotactic factors, including CCL5.
26238523 Study indicates that reduced RKIP expression is correlated with metastasis and recurrence of disease in stage II colorectal cancer (CRC) suggesting it as an important metastasis-suppressor gene in CRC.
26177829 The upregulated expression of RKIP in colorectal cancer cells inhibited cell invasion and metastasis, while downregulation of RKIP reduced chemosensitivity by inhibiting apoptosis induced by HCPT.
More...

AA Sequence

MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTD      1 - 70
PDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSN     71 - 140
RSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK                           141 - 187
//

Text Mined References (196)

PMID Year Title
26859895 2016 Raf Kinase Inhibitor Protein Expression and Prognostic Value in Soft Tissue Sarcomas.
26823735 2015 Raf kinase inhibitor protein (RKIP) inhibits the cell migration and invasion in human glioma cell lines in vitro.
26716415 2016 Regulation of the epithelial to mesenchymal transition and metastasis by Raf kinase inhibitory protein-dependent Notch1 activity.
26617724 2015 Expression of RKIP, E-cadherin and NF-kB p65 in esophageal squamous cell carcinoma and their correlations.
26558823 2016 Human Intestinal Raf Kinase Inhibitor Protein (RKIP) Catalyzes Prasugrel as a Bioactivation Hydrolase.
26479924 2015 Cardiac RKIP induces a beneficial ?-adrenoceptor-dependent positive inotropy.
26308852 2015 RKIP Inhibits Local Breast Cancer Invasion by Antagonizing the Transcriptional Activation of MMP13.
26238785 2015 Metastasis Suppressors Regulate the Tumor Microenvironment by Blocking Recruitment of Prometastatic Tumor-Associated Macrophages.
26238523 2015 Effect of Raf kinase inhibitor protein expression on malignant biological behavior and progression of colorectal cancer.
26177829 2015 Role of Raf-kinase inhibitor protein in colorectal cancer and its regulation by hydroxycamptothecine.
More...