Property Summary

NCBI Gene PubMed Count 29
Grant Count 2
Funding $74,167.6
PubMed Score 87.58
PubTator Score 54.49

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P30085 B4DPU7 E9PGI8 Q53GB7 Q5SVZ0 Q96C07 Q9UBQ8 Q9UIA2
Symbols CK
CMK
UMK
CMPK
UMPK
UMP-CMPK

Gene

PANTHER Protein Class (3)

 Grant Application (2)

PDB

1TEV  

Gene RIF (10)

PMID Text
25659034 The role of CMP/UMP kinase (CMPK), an enzyme catalyzes cytidine diphosphate formation, in DNA repair, was investigated.
24963161 CMPK1 and RBP3 are associated with corneal curvature in Asian populations.
22838950 In particular, polymorphisms of the CMPK1 gene seem to provide important prognostic information
21642870 Single-nucleotide polymorphisms in CMPK1 gene is associated with treatment response in non-small cell lung cancer.
21559290 UMP/CMP kinase (EC 2.7.4.14) is not critical for the phosphorylation of CMP, dCMP and maintenance of natural nucleotide pools in cells
19568409 thymidylate synthase/ribonucleotide reductase gene silencing and deoxycytidine kinase::uridine monophosphate kinase fusion gene gene overexpression markedly improved gemcitabine's therapeutic activity
17608725 Several uracil vinylphosphonate derivatives had affinities for human UMP-CMP kinase similar to those of dUMP
15550676 Models for the phosphorylation action and substrate specificity of human UMP/CMP kinase.
15163660 UMP/CMP kinase reveals the conformational changes that occur upon substrate binding
11912132 Characterization of human UMP/CMP kinase and its phosphorylation of D- and L-form deoxycytidine analogue monophosphates.

AA Sequence

MKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITIS      1 - 70
LLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGR     71 - 140
SDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKEG                  141 - 196
//

Text Mined References (33)

PMID Year Title
25659034 2015 The contribution of CMP kinase to the efficiency of DNA repair.
24963161 2014 CMPK1 and RBP3 are associated with corneal curvature in Asian populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23416111 2013 The human adenylate kinase 9 is a nucleoside mono- and diphosphate kinase.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22838950 2012 Effect of genetic polymorphisms on therapeutic response and clinical outcomes in pancreatic cancer patients treated with gemcitabine.
21642870 2011 Differential effect of polymorphisms of CMPK1 and RRM1 on survival in advanced non-small cell lung cancer patients treated with gemcitabine or taxane/cisplatinum.
21559290 2011 UMP/CMPK is not the critical enzyme in the metabolism of pyrimidine ribonucleotide and activation of deoxycytidine analogs in human RKO cells.
21269460 2011 Initial characterization of the human central proteome.
More...