Property Summary

NCBI Gene PubMed Count 38
PubMed Score 49.54
PubTator Score 27.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.200 5.5e-05
lung cancer 1.400 1.1e-03
ovarian cancer 2.000 3.7e-05
pancreatic ductal adenocarcinoma liver m... -1.511 2.1e-02
tuberculosis 1.200 1.5e-07

Protein-protein Interaction (4)

Gene RIF (19)

AA Sequence

MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELN      1 - 70
QALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFG     71 - 140
GGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVS    141 - 210
KICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFV    211 - 280
EKRKANFKDQ                                                                281 - 290
//

Text Mined References (45)

PMID Year Title