Property Summary

NCBI Gene PubMed Count 30
Grant Count 71
R01 Count 31
Funding $14,291,817.49
PubMed Score 69.65
PubTator Score 64.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Prostatic Neoplasms 471

Expression

Synonym

Accession P30050 Q5VVV2 Q6PB27
Symbols L12

Gene

PDB

4V6X   5AJ0   5A8L  

Gene RIF (4)

PMID Text
22003127 propose that, when not associated with ribosomes, MRPL12 has a second function in transcription, perhaps acting to facilitate the transition from initiation to elongation
20583170 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of ribosomal protein L12 (RPL12) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQ      1 - 70
IEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVG     71 - 140
CNVDGRHPHDIIDDINSGAVECPAS                                                 141 - 165
//

Text Mined References (41)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22314232 2012 Palmitoylated calnexin is a key component of the ribosome-translocon complex.
22003127 2011 Mitochondrial ribosomal protein L12 selectively associates with human mitochondrial RNA polymerase to activate transcription.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...