Property Summary

NCBI Gene PubMed Count 31
PubMed Score 69.56
PubTator Score 64.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0

Expression

Gene RIF (5)

AA Sequence

MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQ      1 - 70
IEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVG     71 - 140
CNVDGRHPHDIIDDINSGAVECPAS                                                 141 - 165
//

Text Mined References (44)

PMID Year Title