Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.43
PubTator Score 1.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Urinary Bladder Neoplasms 114 0.0 0.0
Disease Target Count
Bladder Neoplasm 112
Disease Target Count P-value
ovarian cancer 8520 1.1e-05
Multiple myeloma 1332 4.6e-03

Expression

  Differential Expression (2)

Disease log2 FC p
Multiple myeloma 1.888 4.6e-03
ovarian cancer 2.000 1.1e-05

Gene RIF (2)

AA Sequence

MLPAALLRRPGLGRLVRHARAYAEAAAAPAAASGPNQMSFTFASPTQVFFNGANVRQVDVPTLTGAFGIL      1 - 70
AAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSIAVNADSSVQLLAEEAVTLDMLDLGAAKANLEKAQAE     71 - 140
LVGTADEATRAEIQIRIEANEALVKALE                                              141 - 168
//

Text Mined References (18)

PMID Year Title