Property Summary

NCBI Gene PubMed Count 95
PubMed Score 199.57
PubTator Score 120.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.400 2.2e-02
aldosterone-producing adenoma -1.056 4.6e-02
hereditary spastic paraplegia -1.322 3.9e-04
lung cancer 1.100 4.6e-03
Multiple myeloma 1.375 8.3e-03
ovarian cancer -1.900 1.9e-04
pancreatic ductal adenocarcinoma liver m... -1.738 2.0e-02
Waldenstrons macroglobulinemia 1.562 5.1e-03

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (67)

AA Sequence

MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAP      1 - 70
YFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSH     71 - 140
LAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVE    141 - 210
ETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ                            211 - 256
//

Text Mined References (101)

PMID Year Title