Property Summary

NCBI Gene PubMed Count 87
Grant Count 14
R01 Count 4
Funding $541,500.85
PubMed Score 186.90
PubTator Score 120.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (62)

PMID Text
26797130 Oxidative stress promotes PRX2 and PRX3 hyperoxidation and attenuates pro-survival signaling in aging chondrocytes.
26614766 the species with one disulfide and one hyperoxidized active site was decameric for Prx2 and dimeric for Prx3. Reduction and re-oxidation of the hyperoxidized dimer of Prx3 produced hyperoxidized monomers
26350748 We also found that forkhead box protein 1 (FOXM1)-induced peroxiredoxin 3 (PRDX3) maintains the mitochondrial function, and the FOXM1/PRDX3 mitochondrial pathway maintains survival of colon CSCs
26091938 Colon cancer stem cells overexpress the mitochondrial gene PRX3, which is required for maintenance of mitochondrial function and tumorigenesis, and is regulated by forkhead box protein 1, which also regulates expression of CD133 in these cells.
25743848 High serum PRDX3 levels are associated with hepatocellular carcinoma.
25462069 Peroxiredoxin 3 levels regulate a mitochondrial redox setpoint in malignant mesothelioma cells.
25323516 two placental proteins, Prx3 and Prx4, may act as new placental immune targets.
25093297 HIF-1alpha is a transcription factor for PRDX3 gene expression in clear cell renal cell carcinoma.
24828865 Data indicate that peroxiredoxin III (PrxIII) is a common direct target of both miroRNAs miR-26a-5p and miR-23b-3p.
24815434 Serum PRDX3 can be used as a noninvasive biomarker for the diagnosis and/or prognosis of hepatocellular carcinoma.
More...

AA Sequence

MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAP      1 - 70
YFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSH     71 - 140
LAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVE    141 - 210
ETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ                            211 - 256
//

Text Mined References (93)

PMID Year Title
26797130 2016 Oxidative Stress Promotes Peroxiredoxin Hyperoxidation and Attenuates Pro-survival Signaling in Aging Chondrocytes.
26614766 2016 Kinetic analysis of structural influences on the susceptibility of peroxiredoxins 2 and 3 to hyperoxidation.
26350748 2015 Mitochondrial metabolism in cancer stem cells: a therapeutic target for colon cancer.
26091938 2015 FOXM1-Induced PRX3 Regulates Stemness and Survival of Colon Cancer Cells via Maintenance of Mitochondrial Function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25743848 2015 Plasma nuclear factor kappa B and serum peroxiredoxin 3 in early diagnosis of hepatocellular carcinoma.
25462069 2014 Peroxiredoxin 3 levels regulate a mitochondrial redox setpoint in malignant mesothelioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25323516 2015 Preoxiredoxin family members (Prx3 and Prx4) and pregnancy disorder (recurrent pregnancy loss).
25229973 2014 Forkhead box M1 regulates quiescence-associated radioresistance of human head and neck squamous carcinoma cells.
More...