Property Summary

NCBI Gene PubMed Count 20
PubMed Score 38.78
PubTator Score 25.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Protein-protein Interaction (9)

Gene RIF (14)

AA Sequence

MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSM      1 - 70
TGVGQTLVWCLHKE                                                             71 - 84
//

Text Mined References (24)

PMID Year Title