Property Summary

NCBI Gene PubMed Count 27
Grant Count 3
R01 Count 1
Funding $253,662.66
PubMed Score 60.83
PubTator Score 125.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (12)

PMID Text
26234719 High MIF-2 levels are predictive of the development of organ dysfunction in myocardial ischemia reperfusion injury.
24932684 Both p53 wildtype and mutant human lung adenocarcinoma tumors rely on MIF family members for maximal cell growth and survival.
24356968 findings identify DDT as a functionally redundant but more potent cytokine to MIF in cancer and suggest that current attempts to inhibit MIF signaling may fail because of DDT compensation.
22951300 D-dopachrome tautomerase secreted from adipocytes acts on preadipocytes to promote IL-6 expression and to inhibit adipogenesis by suppressing the induction of genes encoding adipogenic regulators
22428043 DDT acts on adipocytes to regulate lipid metabolism through AMPK and/or PKA pathway(s) and improves glucose intolerance caused by obesity.
21817065 These data indicate that D-DT is a MIF-like cytokine.
21071513 D-DT-dependent beta-catenin stabilization is regulated by COX-2 expression, suggesting the existence of an amplification loop between COX-2- and beta-catenin-mediated transcription in these cells
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18684922 D-dopachrome tautomerase (D-DT) and macrophage migration inhibitory factor, individually and additively, promote vascular endothelial growth factor and CXCL8 expression in human lung adenocarcinoma cell lines.
More...

AA Sequence

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT      1 - 70
AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL                           71 - 118
//

Text Mined References (29)

PMID Year Title
26234719 2015 Interaction of MIF Family Proteins in Myocardial Ischemia/Reperfusion Damage and Their Influence on Clinical Outcome of Cardiac Surgery Patients.
24932684 2014 MIF family members cooperatively inhibit p53 expression and activity.
24356968 2014 Dysregulated D-dopachrome tautomerase, a hypoxia-inducible factor-dependent gene, cooperates with macrophage migration inhibitory factor in renal tumorigenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22951300 2012 D-dopachrome tautomerase promotes IL-6 expression and inhibits adipogenesis in preadipocytes.
22428043 2012 The action of D-dopachrome tautomerase as an adipokine in adipocyte lipid metabolism.
21817065 2011 The D-dopachrome tautomerase (DDT) gene product is a cytokine and functional homolog of macrophage migration inhibitory factor (MIF).
21269460 2011 Initial characterization of the human central proteome.
21071513 2010 The MIF homologue D-dopachrome tautomerase promotes COX-2 expression through ?-catenin-dependent and -independent mechanisms.
More...