Property Summary

NCBI Gene PubMed Count 32
PubMed Score 64.51
PubTator Score 125.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
diabetes mellitus -1.400 7.3e-03
group 4 medulloblastoma -1.100 3.5e-03
intraductal papillary-mucinous carcinoma... -1.200 3.8e-02
intraductal papillary-mucinous neoplasm ... -1.400 4.5e-02
osteosarcoma -1.179 5.5e-04
ovarian cancer 1.300 9.6e-04
pancreatic ductal adenocarcinoma liver m... -1.515 1.9e-02
psoriasis -1.400 5.4e-04

Gene RIF (17)

AA Sequence

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT      1 - 70
AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL                           71 - 118
//

Text Mined References (34)

PMID Year Title