Property Summary

NCBI Gene PubMed Count 62
PubMed Score 950.16
PubTator Score 472.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
nasopharyngeal carcinoma 1058 2.6e-04
ovarian cancer 8519 6.5e-04
interstitial cystitis 2312 7.3e-04
Disease Target Count Z-score Confidence
Alopecia areata 41 0.0 2.1
Crohn's disease 321 0.0 3.0

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.100 7.3e-04
nasopharyngeal carcinoma -1.100 2.6e-04
ovarian cancer -1.300 6.5e-04

Gene RIF (34)

AA Sequence

MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEG      1 - 70
EPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRA     71 - 140
HKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI    141 - 210
ISQL                                                                      211 - 214
//

Text Mined References (68)

PMID Year Title