Property Summary

NCBI Gene PubMed Count 56
Grant Count 283
R01 Count 199
Funding $24,385,860.48
PubMed Score 1006.31
PubTator Score 472.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.100 0.001
nasopharyngeal carcinoma -1.100 0.000
ovarian cancer 2.700 0.000

Synonym

Accession P30044 A6NC19 A6NG06 B7ZLJ4 B7ZVW3 Q14CK0 Q6IAF2 Q9UBU5 Q9UJU4 Q9UKX4
Symbols PLP
ACR1
B166
PRXV
PMP20
PRDX6
prx-V
SBBI10
AOEB166
HEL-S-55

Gene

PDB

1H4O   1HD2   1OC3   1URM   2VL2   2VL3   2VL9   3MNG   4K7I   4K7N   4K7O   4MMM  

Gene RIF (33)

PMID Text
25772011 peroxisomal PRDX5 protects oligodendrocytes against peroxisomal and mitochondrial oxidative stress.
25025339 show here how the ligand-observed saturation transfer difference (STD) experiment and the PRDX5 protein-observed 15N-HSQC experiment, two popular NMR screening experiments, can be used to compare the binding modes of analogous fragments
24385276 PRX5 is either consumed or its production is impaired in severe stroke
23216451 This study demonistrated that overexpression of mitochondrial PRDX5 protects SH-SY5Y cells against the ROS/RNS-dependent neuronal death induced by MPP+.
22020876 The promoter region critical for Prx5 gene regulation to which the novel negative transcription regulator, GATA1 binds in human breast cancer cell lines.
20937353 basal expression of the human PRDX5 gene is regulated by GABP
20877624 Observational study of gene-disease association. (HuGE Navigator)
20596022 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20305821 analysis of fragment molecules that bind the human peroxiredoxin 5 active site
19336475 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGLAGVCALRRSAGYILVGGAGGQSAAAAARRYSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEG      1 - 70
EPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRA     71 - 140
HKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI    141 - 210
ISQL                                                                      211 - 214
//

Text Mined References (63)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772011 2015 Antioxidant cytoprotection by peroxisomal peroxiredoxin-5.
25025339 2014 Comparing binding modes of analogous fragments using NMR in fragment-based drug design: application to PRDX5.
24385276 2014 Peroxiredoxin 5 (PRX5) is correlated inversely to systemic markers of inflammation in acute stroke.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23216451 2013 Mitochondrial peroxiredoxin-5 as potential modulator of mitochondria-ER crosstalk in MPP+-induced cell death.
22837380 2012 A novel sarcoidosis risk locus for Europeans on chromosome 11q13.1.
More...