Property Summary

NCBI Gene PubMed Count 21
PubMed Score 194.86
PubTator Score 38.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
diabetes mellitus -1.200 1.3e-03
group 4 medulloblastoma -1.100 1.2e-03
lung cancer -1.200 2.0e-04
lung carcinoma -1.100 1.1e-21
malignant mesothelioma 1.900 4.8e-07
medulloblastoma, large-cell -2.000 7.8e-06
mucosa-associated lymphoid tissue lympho... 2.024 7.6e-03
non primary Sjogren syndrome sicca 1.100 3.6e-02
osteosarcoma -2.967 4.6e-05
ovarian cancer -1.800 7.2e-06
pancreatic ductal adenocarcinoma liver m... -1.316 3.4e-03
primitive neuroectodermal tumor -1.100 2.1e-02
subependymal giant cell astrocytoma 1.282 3.8e-02
tuberculosis 1.600 6.1e-07

Gene RIF (4)

AA Sequence

MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDA      1 - 70
VIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLR     71 - 140
ESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ        141 - 206
//

Text Mined References (28)

PMID Year Title