Property Summary

NCBI Gene PubMed Count 20
Grant Count 15
R01 Count 8
Funding $1,201,683.5
PubMed Score 179.30
PubTator Score 38.55

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26708147 miR-127-5p suppressed NF-kappaB activity by directly targeting BLVRB in hepatocellular carcinoma cells.
25726384 Data suggest that isoenzymes BVRA and BVRB play different roles in energy metabolism and in pathogenesis of abdominal obesity and hypertriglyceridemia. [REVIEW]
18241201 quantum mechanics/molecular mechanics potential energy surfaces show that the lowest energy pathway proceeds with a positively charged pyrrole intermediate via two transition states

AA Sequence

MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDA      1 - 70
VIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLR     71 - 140
ESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ        141 - 206
//

Text Mined References (27)

PMID Year Title
26708147 2016 MicroRNA-127-5p targets the biliverdin reductase B/nuclear factor-?B pathway to suppress cell growth in hepatocellular carcinoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25726384 2015 Biliverdin reductase isozymes in metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18241201 2008 Computational and experimental studies on the catalytic mechanism of biliverdin-IXbeta reductase.
More...