Property Summary

NCBI Gene PubMed Count 20
PubMed Score 179.30
PubTator Score 38.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.05839706296177E-21
malignant mesothelioma 3163 4.76812481979413E-7
tuberculosis 1563 6.14061860073815E-7
ovarian cancer 8492 7.16440387368081E-6
medulloblastoma, large-cell 6234 7.831502176659E-6
osteosarcoma 7933 4.56095384973674E-5
lung cancer 4473 2.01973294481405E-4
group 4 medulloblastoma 1875 0.00119907194840458
diabetes mellitus 1663 0.00130024376085384
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00338045104389713
mucosa-associated lymphoid tissue lymphoma 480 0.00757593814309015
primitive neuroectodermal tumor 3031 0.0208650981004346
non primary Sjogren syndrome sicca 840 0.0355517915482928
subependymal giant cell astrocytoma 2287 0.0379855514239005
Disease Target Count Z-score Confidence
Asymptomatic dengue 5 3.279 1.6

Expression

Synonym

Accession P30043 A6NKD8 B2R5C6 P32078 P53005 Q32LZ2 FR
Symbols FLR
BVRB
SDR43U1
HEL-S-10

Gene

PANTHER Protein Class (2)

PDB

1HDO   1HE2   1HE3   1HE4   1HE5  

  Ortholog (12)

Gene RIF (3)

PMID Text
26708147 miR-127-5p suppressed NF-kappaB activity by directly targeting BLVRB in hepatocellular carcinoma cells.
25726384 Data suggest that isoenzymes BVRA and BVRB play different roles in energy metabolism and in pathogenesis of abdominal obesity and hypertriglyceridemia. [REVIEW]
18241201 quantum mechanics/molecular mechanics potential energy surfaces show that the lowest energy pathway proceeds with a positively charged pyrrole intermediate via two transition states

AA Sequence

MAVKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAHVVVGDVLQAADVDKTVAGQDA      1 - 70
VIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDHIRMHKVLR     71 - 140
ESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHSTYPSHQYQ        141 - 206
//

Text Mined References (27)

PMID Year Title
26708147 2016 MicroRNA-127-5p targets the biliverdin reductase B/nuclear factor-?B pathway to suppress cell growth in hepatocellular carcinoma cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25726384 2015 Biliverdin reductase isozymes in metabolism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18241201 2008 Computational and experimental studies on the catalytic mechanism of biliverdin-IXbeta reductase.
More...