Property Summary

NCBI Gene PubMed Count 21
PubMed Score 243.25
PubTator Score 68.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Ewing sarcoma 25 4.58 2.3
Sarcoma 62 4.275 2.1
Migraine 83 3.144 1.6

Expression

Gene RIF (2)

AA Sequence

MAAVRVLVASRLAAASAFTSLSPGGRTPSQRAALHLSVPRPAARVALVLSGCGVYDGTEIHEASAILVHL      1 - 70
SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAA     71 - 140
KNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTA    141 - 210
EAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK                211 - 268
//

Text Mined References (22)

PMID Year Title