Property Summary

NCBI Gene PubMed Count 105
PubMed Score 435.34
PubTator Score 128.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
active ulcerative colitis -1.199 4.0e-03
acute quadriplegic myopathy 1.056 1.1e-04
fibroadenoma -1.300 4.0e-02
group 4 medulloblastoma -1.100 3.2e-04
lung cancer 1.300 6.1e-04
Multiple myeloma 1.603 1.7e-03
ovarian cancer 1.200 1.1e-02
pancreatic ductal adenocarcinoma liver m... -1.530 1.5e-02
psoriasis -1.100 4.9e-04
spina bifida -1.258 4.1e-02

Gene RIF (72)

AA Sequence

MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA      1 - 70
LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD     71 - 140
KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE    141 - 210
LPSGKKYLRYTPQP                                                            211 - 224
//

Text Mined References (116)

PMID Year Title