Property Summary

NCBI Gene PubMed Count 93
Grant Count 91
R01 Count 40
Funding $17,320,763.54
PubMed Score 417.15
PubTator Score 128.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.603 0.002
psoriasis -1.100 0.000
ulcerative colitis -1.700 0.000
acute quadriplegic myopathy 1.056 0.000
pancreatic ductal adenocarcinoma liver m... -1.530 0.015
lung cancer 1.300 0.001
fibroadenoma -1.300 0.040
group 4 medulloblastoma -1.300 0.000
spina bifida -1.301 0.039
ovarian cancer 1.200 0.011

Synonym

Accession P30041 A8JZY7 P32077 Q5TAH4 Q5ZEZ8
Symbols PRX
p29
AOP2
1-Cys
NSGPx
aiPLA2
HEL-S-128m

Gene

PANTHER Protein Class (2)

PDB

1PRX   5B6M   5B6N  

Gene RIF (63)

PMID Text
26921317 Thr can substitute for Ser for the enzymatic activities of Prdx6 but not for its targeting to LB. These results confirm an important role for LB Prdx6 in the degradation and remodeling of lung surfactant phosphatidylcholine.
26647763 Prdx6 and its PLA2 activity have a protective role in donors after brain death livers.
26447207 Delivery of a protein transduction domain-mediated Prdx6 protein protected against oxidative stress-evoked neuronal cell death.
26285655 AA (arachidonic acid) as a crucial effector of PRDX6-dependent proliferation and inducer of Src family kinase activation.
26279427 PRDX6 protects ARPE-19 cells from hydrogen peroxide-induced oxidative stress and apoptosis.
25938937 PRDX6 may serve as a biomarker for traumatic brain injury and that autoimmune profiling is a viable strategy for the discovery of novel biomarkers
25935550 High intensity of cytoplasmic Prx VI expression in pretreatment diffuse large B-cell lymphoma samples predicts worse outcome.
25748205 Several regions of reduced PRDX6 are in a substantially different conformation from that of the crystal structure of the peroxidase catalytic intermediate. The differences between the two structures likely reflect catalysis-related conformational changes.
24910119 Reactive oxygen species-evoked aberrant sumoylation signaling affects Prdx6 activity by reducing Prdx6 abundance.
24512906 our findings indicate that PRDX6 promotes lung tumor growth via increased glutathione peroxidase and iPLA2 activities.
More...

AA Sequence

MPGGLLLGDVAPNFEANTTVGRIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIA      1 - 70
LSIDSVEDHLAWSKDINAYNCEEPTEKLPFPIIDDRNRELAILLGMLDPAEKDEKGMPVTARVVFVFGPD     71 - 140
KKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKE    141 - 210
LPSGKKYLRYTPQP                                                            211 - 224
//

Text Mined References (104)

PMID Year Title
26921317 2016 Mutation of Serine 32 to Threonine in Peroxiredoxin 6 Preserves Its Structure and Enzymatic Function but Abolishes Its Trafficking to Lamellar Bodies.
26647763 2016 Peroxiredoxin 6 attenuates ischemia? and hypoxia?induced liver damage of brain?dead donors.
26447207 2016 Delivery of a protein transduction domain-mediated Prdx6 protein ameliorates oxidative stress-induced injury in human and mouse neuronal cells.
26285655 2015 Peroxiredoxin 6 triggers melanoma cell growth by increasing arachidonic acid-dependent lipid signalling.
26279427 2015 PRDX6 Protects ARPE-19 Cells from Oxidative Damage via PI3K/AKT Signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25938937 2015 Autoimmune Profiling Reveals Peroxiredoxin 6 as a Candidate Traumatic Brain Injury Biomarker.
25935550 2015 High intensity of cytoplasmic peroxiredoxin VI expression is associated with adverse outcome in diffuse large B-cell lymphoma independently of International Prognostic Index.
25748205 2015 Solution structure of the reduced form of human peroxiredoxin-6 elucidated using zero-length chemical cross-linking and homology modelling.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
More...