Property Summary

NCBI Gene PubMed Count 42
Grant Count 14
R01 Count 13
Funding $2,182,728.1
PubMed Score 62.75
PubTator Score 52.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.015 0.001
psoriasis -1.500 0.000
osteosarcoma -1.631 0.000
ovarian cancer -1.300 0.000

Gene RIF (26)

PMID Text
26431474 Endoplasmic reticulum protein 29 attenuates CSE-induced ER stress and enhances cell viability and barrier integrity of RPE cells, and therefore may act as a protective mechanism for RPE survival and activity.
26420420 our studies prove a novel function of ERp29\MGMT in cancer cell survival against radiation. Targeting ERp29\MGMT axis may be useful for providing better treatment efficacy in combination with radiotherapy in breast cancer.
24944201 ERp29 directs ENaC toward the Golgi, where it undergoes cleavage during its biogenesis and trafficking to the apical membrane.
24916695 CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer.
24780196 overexpression of ERp29 may play a key role in apoptosis in HTR-8/SVneo cells via activation of p38, which may participate in the pathogenesis of intrahepatic cholestasis of pregnancy
24391750 Apoptosis related proteins ERp29, PRDX6 and MPO were differentially expressed in placentas of pregnant women with intrahepatic cholestasis and in healthy pregnant women.
23558074 S1P1 overexpression or ERp29 absence is related to the carcinogenesis and progression, and may be potential biomarkers for early detection of gallbladder adenocarcinoma.
22543584 ERp29 is a novel molecule that regulates MET and epithelial cell integrity in breast cancer cells.
22160175 Suggest that ERp29 associates with radioresistance in nasopharyngeal carcinoma and may be potential biomarker for predicting response to radiotherapy.
22064321 interplay between p38 phosphorylation and p58(IPK) upregulation has key roles in modulating ERp29-induced cell-growth arrest and survival
More...

AA Sequence

MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ      1 - 70
DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA     71 - 140
IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL    141 - 210
DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL                       211 - 261
//

Text Mined References (49)

PMID Year Title
26431474 2015 Erp29 Attenuates Cigarette Smoke Extract-Induced Endoplasmic Reticulum Stress and Mitigates Tight Junction Damage in Retinal Pigment Epithelial Cells.
26420420 2015 Endoplasmic reticulum protein 29 (ERp29) confers radioresistance through the DNA repair gene, O(6)-methylguanine DNA-methyltransferase, in breast cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25171405 2014 A secreted tyrosine kinase acts in the extracellular environment.
24944201 2014 ERp29 regulates epithelial sodium channel functional expression by promoting channel cleavage.
24916695 2014 CLIC4, ERp29, and Smac/DIABLO derived from metastatic cancer stem-like cells stratify prognostic risks of colorectal cancer.
24780196 2014 High concentraction of taurocholic acid induced apoptosis in HTR-8/SVneo cells via overexpression of ERp29 and activation of p38.
24391750 2013 Comparative proteomics analysis of placenta from pregnant women with intrahepatic cholestasis of pregnancy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23558074 2013 Correlation of S1P1 and ERp29 expression to progression, metastasis, and poor prognosis of gallbladder adenocarcinoma.
More...