Tbio | Endoplasmic reticulum resident protein 29 |
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
This gene encodes a reticuloplasmin, a protein which resides in the lumen of the endoplasmic reticulum (ER). The protein shows sequence similarity to the protein disulfide isomerase family. However, it lacks the thioredoxin motif characteristic of this family, suggesting that this protein does not function as a disulfide isomerase. The protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Adenocarcinoma of lung (disorder) | 48 |
Liver carcinoma | 217 |
Neoplasm Metastasis | 138 |
Prostatic Neoplasms | 471 |
Disease | Target Count | P-value |
---|---|---|
osteosarcoma | 7933 | 1.05247757975775E-7 |
psoriasis | 6685 | 2.76354019332802E-4 |
ovarian cancer | 8492 | 3.57587516881641E-4 |
Multiple myeloma | 1328 | 0.00141930270694027 |
Disease | log2 FC | p |
---|---|---|
Multiple myeloma | 1.015 | 0.001 |
psoriasis | -1.500 | 0.000 |
osteosarcoma | -1.631 | 0.000 |
ovarian cancer | -1.300 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG |
PMID | Text |
---|---|
26431474 | Endoplasmic reticulum protein 29 attenuates CSE-induced ER stress and enhances cell viability and barrier integrity of RPE cells, and therefore may act as a protective mechanism for RPE survival and activity. |
26420420 | our studies prove a novel function of ERp29\MGMT in cancer cell survival against radiation. Targeting ERp29\MGMT axis may be useful for providing better treatment efficacy in combination with radiotherapy in breast cancer. |
24944201 | ERp29 directs ENaC toward the Golgi, where it undergoes cleavage during its biogenesis and trafficking to the apical membrane. |
24916695 | CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer. |
24780196 | overexpression of ERp29 may play a key role in apoptosis in HTR-8/SVneo cells via activation of p38, which may participate in the pathogenesis of intrahepatic cholestasis of pregnancy |
24391750 | Apoptosis related proteins ERp29, PRDX6 and MPO were differentially expressed in placentas of pregnant women with intrahepatic cholestasis and in healthy pregnant women. |
23558074 | S1P1 overexpression or ERp29 absence is related to the carcinogenesis and progression, and may be potential biomarkers for early detection of gallbladder adenocarcinoma. |
22543584 | ERp29 is a novel molecule that regulates MET and epithelial cell integrity in breast cancer cells. |
22160175 | Suggest that ERp29 associates with radioresistance in nasopharyngeal carcinoma and may be potential biomarker for predicting response to radiotherapy. |
22064321 | interplay between p38 phosphorylation and p58(IPK) upregulation has key roles in modulating ERp29-induced cell-growth arrest and survival |
More... |
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ 1 - 70 DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA 71 - 140 IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL 141 - 210 DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL 211 - 261 //
PMID | Year | Title |
---|---|---|
26431474 | 2015 | Erp29 Attenuates Cigarette Smoke Extract-Induced Endoplasmic Reticulum Stress and Mitigates Tight Junction Damage in Retinal Pigment Epithelial Cells. |
26420420 | 2015 | Endoplasmic reticulum protein 29 (ERp29) confers radioresistance through the DNA repair gene, O(6)-methylguanine DNA-methyltransferase, in breast cancer cells. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
25171405 | 2014 | A secreted tyrosine kinase acts in the extracellular environment. |
24944201 | 2014 | ERp29 regulates epithelial sodium channel functional expression by promoting channel cleavage. |
24916695 | 2014 | CLIC4, ERp29, and Smac/DIABLO derived from metastatic cancer stem-like cells stratify prognostic risks of colorectal cancer. |
24780196 | 2014 | High concentraction of taurocholic acid induced apoptosis in HTR-8/SVneo cells via overexpression of ERp29 and activation of p38. |
24391750 | 2013 | Comparative proteomics analysis of placenta from pregnant women with intrahepatic cholestasis of pregnancy. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23558074 | 2013 | Correlation of S1P1 and ERp29 expression to progression, metastasis, and poor prognosis of gallbladder adenocarcinoma. |
More... |