| Tbio | Endoplasmic reticulum resident protein 29 |
Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]
Comments
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Adenocarcinoma of lung | 142 | 0.0 | 0.0 |
| Carcinoma, Hepatocellular | 228 | 0.0 | 0.0 |
| Neoplasm Metastasis | 168 | 0.0 | 0.0 |
| Prostatic Neoplasms | 495 | 0.0 | 0.0 |
| Disease | Target Count |
|---|---|
| Adenocarcinoma of lung (disorder) | 60 |
| Liver carcinoma | 240 |
| Disease | Target Count | P-value |
|---|---|---|
| osteosarcoma | 7950 | 1.1e-07 |
| psoriasis | 6694 | 2.8e-04 |
| ovarian cancer | 8520 | 3.6e-04 |
| Multiple myeloma | 1332 | 1.4e-03 |
| Disease | log2 FC | p |
|---|---|---|
| Multiple myeloma | 1.015 | 1.4e-03 |
| osteosarcoma | -1.631 | 1.1e-07 |
| ovarian cancer | -1.300 | 3.6e-04 |
| psoriasis | -1.500 | 2.8e-04 |
| Species | Source | Disease |
|---|---|---|
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| OMA EggNOG | ||
| Inparanoid EggNOG |
MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ 1 - 70 DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA 71 - 140 IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL 141 - 210 DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL 211 - 261 //
