Property Summary

NCBI Gene PubMed Count 46
PubMed Score 65.86
PubTator Score 52.16

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.015 1.4e-03
osteosarcoma -1.631 1.1e-07
ovarian cancer -1.300 3.6e-04
psoriasis -1.500 2.8e-04

Synonym

Accession P30040 C9J183 Q3MJC3 Q6FHT4 ERp29
Symbols ERp28
ERp31
PDIA9
PDI-DB
C12orf8
HEL-S-107

Gene

PANTHER Protein Class (1)

PDB

5V90   2QC7   5V8Z  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

Gene RIF (30)

AA Sequence

MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQ      1 - 70
DEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGA     71 - 140
IQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKIL    141 - 210
DQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL                       211 - 261
//

Text Mined References (53)

PMID Year Title