Property Summary

NCBI Gene PubMed Count 19
PubMed Score 51.77
PubTator Score 15.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.747 0.010
esophageal adenocarcinoma -1.500 0.018
osteosarcoma -1.041 0.000
group 3 medulloblastoma -1.800 0.002
medulloblastoma, large-cell -1.300 0.009
primitive neuroectodermal tumor -1.100 0.029
Atopic dermatitis 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -2.561 0.017
lung cancer 1.200 0.000
interstitial cystitis -2.900 0.000
psoriasis 1.200 0.000

Synonym

Gene

PANTHER Protein Class (2)

PDB

3V9G   3V9H   3V9I   4OE5  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (6)

PMID Text
22516612 the impact of the hyperprolinemia-associated mutation of Ser352 to Leu on the structure and catalytic properties of the P5CDH
20877624 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
14986171 ALDH4 is a p53-inducible gene with a protective role in cellular stresses
14986171 ALDH4 is transcriptionally induced by p53.

AA Sequence

MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGD      1 - 70
EEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRR     71 - 140
AEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPF    141 - 210
NFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLC    211 - 280
GINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSA    281 - 350
CSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK    351 - 420
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVV    421 - 490
QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYA    491 - 560
YMQ                                                                       561 - 563
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23825041 2013 A novel ALDH5A1 mutation is associated with succinic semialdehyde dehydrogenase deficiency and severe intellectual disability in an Iranian family.
23568457 2013 Genetic variants associated with disordered eating.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22516612 2012 The three-dimensional structural basis of type II hyperprolinemia.
21998747 2011 Structural and biochemical studies of human 4-hydroxy-2-oxoglutarate aldolase: implications for hydroxyproline metabolism in primary hyperoxaluria.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
More...