Property Summary

NCBI Gene PubMed Count 19
PubMed Score 52.79
PubTator Score 15.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Atopic dermatitis 1.400 1.2e-04
esophageal adenocarcinoma -1.500 1.8e-02
group 3 medulloblastoma -1.800 1.9e-03
interstitial cystitis -1.900 4.2e-03
lung cancer 1.200 1.5e-04
medulloblastoma, large-cell -1.300 9.4e-03
nephrosclerosis -1.747 1.0e-02
osteosarcoma -1.041 8.8e-06
pancreatic ductal adenocarcinoma liver m... -2.561 1.7e-02
primitive neuroectodermal tumor -1.100 2.9e-02
psoriasis 1.200 2.5e-43

Gene RIF (6)

AA Sequence

MLLPAPALRRALLSRPWTGAGLRWKHTSSLKVANEPVLAFTQGSPERDALQKALKDLKGRMEAIPCVVGD      1 - 70
EEVWTSDVQYQVSPFNHGHKVAKFCYADKSLLNKAIEAALAARKEWDLKPIADRAQIFLKAADMLSGPRR     71 - 140
AEILAKTMVGQGKTVIQAEIDAAAELIDFFRFNAKYAVELEGQQPISVPPSTNSTVYRGLEGFVAAISPF    141 - 210
NFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLC    211 - 280
GINFTGSVPTFKHLWKQVAQNLDRFHTFPRLAGECGGKNFHFVHRSADVESVVSGTLRSAFEYGGQKCSA    281 - 350
CSRLYVPHSLWPQIKGRLLEEHSRIKVGDPAEDFGTFFSAVIDAKSFARIKKWLEHARSSPSLTILAGGK    351 - 420
CDDSVGYFVEPCIVESKDPQEPIMKEEIFGPVLSVYVYPDDKYKETLQLVDSTTSYGLTGAVFSQDKDVV    421 - 490
QEATKVLRNAAGNFYINDKSTGSIVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWSYA    491 - 560
YMQ                                                                       561 - 563
//

Text Mined References (26)

PMID Year Title