Property Summary

Ligand Count 27
NCBI Gene PubMed Count 25
PubMed Score 67.83
PubTator Score 89.02

Knowledge Summary

Patent (11,935)

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.8e-30
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hypertrophic cardiomyopathy 20 12 3.523 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 5.8e-30

Gene RIF (9)

AA Sequence

MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLFIFRLRPWDAT      1 - 70
ATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLYCSVLFLTCISVHRYLGICHP     71 - 140
LRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKGTTVLCHDTTRPEEFDHYVHFSSAVMGLLFG    141 - 210
VPCLVTLVCYGLMARRLYQPLPGSAQSSSRLRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRV    211 - 280
LNIVNVVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAA    281 - 350
TPQDSSCSTPRADRL                                                           351 - 365
//

Text Mined References (25)

PMID Year Title