Property Summary

NCBI Gene PubMed Count 25
PubMed Score 65.93
PubTator Score 89.02

Knowledge Summary

Patent (11,935)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 5.8e-30

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 5.8e-30

Gene RIF (9)

PMID Text
25003238 reflected in the immunoblotting data P2RY4 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy.
22776902 show that P2 receptors and protein kinases are also involved in regulating injury-induced expression and the release of TSP-1 in injured astrocytes
22052557 P2Y4 receptors are expressed in intracellular vesicles and sarcolemma of skeletal muscle fibers.
21219331 Nucleotide P2Y4 receptor binding is arrested in post-Golgi trafficking by type I transmembrane proteins p23 and p24A.
15649700 Taken together, our data indicate that the high expression and activation of the P2Y4 receptor participates in the neuronal differentiation and commitment to death of SH-SY5Y cells.
14670966 second extracellular loop and the NH(2) terminus form a functional motif that plays a key role in determining whether ATP functions as an agonist or antagonist at mammalian P2Y(4) receptors
12623123 Activation of the human P2Y(4) receptor expressed in 1321N1 cells by UTP did not elicit this protective effect, although both receptors were coupled to phospholipase C.
12603858 Human keratinocytes express multiple P2Y-receptors: evidence for functional P2Y1, P2Y2, and P2Y4 receptors.
11690642 expression profile in human peripheral tissues and brain regions using PCR

AA Sequence

MASTESSLLRSLGLSPGPGSSEVELDCWFDEDFKFILLPVSYAVVFVLGLGLNAPTLWLFIFRLRPWDAT      1 - 70
ATYMFHLALSDTLYVLSLPTLIYYYAAHNHWPFGTEICKFVRFLFYWNLYCSVLFLTCISVHRYLGICHP     71 - 140
LRALRWGRPRLAGLLCLAVWLVVAGCLVPNLFFVTTSNKGTTVLCHDTTRPEEFDHYVHFSSAVMGLLFG    141 - 210
VPCLVTLVCYGLMARRLYQPLPGSAQSSSRLRSLRTIAVVLTVFAVCFVPFHITRTIYYLARLLEADCRV    211 - 280
LNIVNVVYKVTRPLASANSCLDPVLYLLTGDKYRRQLRQLCGGGKPQPRTAASSLALVSLPEDSSCRWAA    281 - 350
TPQDSSCSTPRADRL                                                           351 - 365
//

Text Mined References (25)

PMID Year Title
25003238 2014 Expression of astrocyte-related receptors in cortical dysplasia with intractable epilepsy.
22776902 2012 Trauma-induced expression of astrocytic thrombospondin-1 is regulated by P2 receptors coupled to protein kinase cascades.
22052557 2012 Purinergic receptors expressed in human skeletal muscle fibres.
21219331 2011 Proteinase-activated receptors, nucleotide P2Y receptors, and ?-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.
19900397 2010 ATP modulates transcription factors through P2Y2 and P2Y4 receptors via PKC/MAPKs and PKC/Src pathways in MCF-7 cells.
19836435 2009 Extracellular ATP activates MAP kinase cascades through a P2Y purinergic receptor in the human intestinal Caco-2 cell line.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
15772651 2005 The DNA sequence of the human X chromosome.
15649700 2005 The metabotropic P2Y4 receptor participates in the commitment to differentiation and cell death of human neuroblastoma SH-SY5Y cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14670966 2004 Agonist versus antagonist action of ATP at the P2Y4 receptor is determined by the second extracellular loop.
12623123 2003 Tumor necrosis factor alpha-induced apoptosis in astrocytes is prevented by the activation of P2Y6, but not P2Y4 nucleotide receptors.
12603858 2003 Human keratinocytes express multiple P2Y-receptors: evidence for functional P2Y1, P2Y2, and P2Y4 receptors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12130504 2002 Nucleotides induce chemotaxis and actin polymerization in immature but not mature human dendritic cells via activation of pertussis toxin-sensitive P2y receptors.
11690642 2001 Expression pattern of human P2Y receptor subtypes: a quantitative reverse transcription-polymerase chain reaction study.
11290369 2001 Molecular cloning and characterization of the mouse P2Y4 nucleotide receptor.
11114308 2001 Differential regulation of the uridine nucleotide-activated P2Y4 and P2Y6 receptors. SER-333 and SER-334 in the carboxyl terminus are involved in agonist-dependent phosphorylation desensitization and internalization of the P2Y4 receptor.
9535005 1998 Distribution of P2Y receptor subtypes on haematopoietic cells.
9268704 1997 Cloning of P2Y6 cDNAs and identification of a pseudogene: comparison of P2Y receptor subtype expression in bone and brain tissues.
8700127 1996 Uridine nucleotide selectivity of three phospholipase C-activating P2 receptors: identification of a UDP-selective, a UTP-selective, and an ATP- and UTP-specific receptor.
8617367 1996 Molecular cloning and characterization of a novel orphan receptor (P2P) expressed in human pancreas that shows high structural homology to the P2U purinoceptor.
8537336 1995 Cloning and functional expression of a human uridine nucleotide receptor.
8537335 1995 Cloning, expression, and chromosomal localization of the human uridine nucleotide receptor gene.