Property Summary

NCBI Gene PubMed Count 34
PubMed Score 45.23
PubTator Score 55.69

Knowledge Summary

Patent (5,467)

Expression

  Differential Expression (27)

Disease log2 FC p
Waldenstrons macroglobulinemia -3.141 2.4e-03
astrocytic glioma -1.300 4.7e-02
psoriasis -1.300 8.8e-04
non diabetic and post-ischemic heart fai... 1.500 3.2e-03
type II diabetes mellitus and post-ische... 1.600 2.4e-02
atypical teratoid/rhabdoid tumor -1.300 1.8e-03
medulloblastoma, large-cell -1.800 1.8e-04
tuberculosis and treatment for 6 months -1.400 2.8e-02
non-small cell lung cancer -1.961 3.9e-22
intraductal papillary-mucinous adenoma (... -2.400 4.0e-03
intraductal papillary-mucinous carcinoma... -3.000 1.4e-03
intraductal papillary-mucinous neoplasm ... -2.700 1.8e-02
lung cancer -4.500 3.6e-07
colon cancer -2.900 1.6e-04
sarcoidosis 1.300 4.0e-02
breast carcinoma -1.300 4.1e-04
lung adenocarcinoma -2.283 3.6e-10
primary Sjogren syndrome 1.500 3.1e-03
Endometriosis 1.802 4.0e-02
Pick disease 1.300 6.1e-03
ductal carcinoma in situ -1.700 5.6e-03
invasive ductal carcinoma -2.500 8.2e-04
acute myeloid leukemia -2.300 6.5e-03
ulcerative colitis 1.100 2.5e-02
ovarian cancer -1.200 7.3e-05
dermatomyositis 1.300 1.2e-03
head and neck cancer -1.400 3.5e-02

 GWAS Trait (1)

Gene RIF (9)

PMID Text
24847057 UDP-glucose activates P2Y14 receptor and JAK2, increases STAT3 Tyr705 phosphorylation, and enhances transcription of HAS2.
23592514 PPTN as a highly selective high-affinity antagonist of the P2Y14-R.
23333304 HIV-1 Vif downregulates the expression of purinergic receptor P2Y, G-protein coupled, 14 (P2RY14) in Vif-expression T cells
22673622 These results support the notion that UDP-glucose is a stable and potent proinflammatory mediator that promotes P2Y(14)-R-mediated neutrophil motility via Rho/Rho kinase activation.
19454705 UDP-glucose stimulated IL-8 production via P2RY14 in human endometrial epithelial cells but not stromal cells
18690346 We have demonstrated the presence of P2Y(14) receptor protein in platelets, but no contribution of this receptor to several measures of platelet function has been observed
12902497 Discrete expression of GPR105 demonstrated within the immature subset of monocyte-derived dendritic cells (DC) suggests a possible role for this receptor in DC activation.
12842911 a G-protein-coupled receptor identifying a quiescent, primitive population of hematopoietic cells restricted to bone marrow; it mediates primitive cell responses to specific hematopoietic microenvironments
12559763 The IUPHAR Subcommittee for P2Y receptor nomenclature and classification reviews the current knowledge of the UDP-glucose receptor and presents reasons for including it in the P2Y receptor family as the P2Y(14) receptor.

AA Sequence

MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYVPSSKSFIIYLKNIVIADFVM      1 - 70
SLTFPFKILGDSGLGPWQLNVFVCRVSAVLFYVNMYVSIVFFGLISFDRYYKIVKPLWTSFIQSVSYSKL     71 - 140
LSVIVWMLMLLLAVPNIILTNQSVREVTQIKCIELKSELGRKWHKASNYIFVAIFWIVFLLLIVFYTAIT    141 - 210
KKIFKSHLKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYHIARIPYTKSQTEAHYSCQSKEILRYMKEFT    211 - 280
LLLSAANVCLDPIIYFFLCQPFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL                281 - 338
//

Text Mined References (35)

PMID Year Title
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24847057 2014 Extracellular UDP-glucose activates P2Y14 Receptor and Induces Signal Transducer and Activator of Transcription 3 (STAT3) Tyr705 phosphorylation and binding to hyaluronan synthase 2 (HAS2) promoter, stimulating hyaluronan synthesis of keratinocytes.
23592514 2013 A selective high-affinity antagonist of the P2Y14 receptor inhibits UDP-glucose-stimulated chemotaxis of human neutrophils.
22673622 2012 The UDP-sugar-sensing P2Y(14) receptor promotes Rho-mediated signaling and chemotaxis in human neutrophils.
19454705 2009 The UDP-glucose receptor P2RY14 triggers innate mucosal immunity in the female reproductive tract by inducing IL-8.
18690346 2008 Detection of P2Y(14) protein in platelets and investigation of the role of P2Y(14) in platelet function in comparison with the EP(3) receptor.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17088057 2007 Molecular dynamics simulation of the P2Y14 receptor. Ligand docking and identification of a putative binding site of the distal hexose moiety.
17016747 Defining the nucleotide binding sites of P2Y receptors using rhodopsin-based homology modeling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16820147 2006 Functional expression of the P2Y14 receptor in human neutrophils.
16475938 2006 P2 receptors activated by uracil nucleotides--an update.
16263727 2006 Creation of GPCR-based chemical sensors by directed evolution in yeast.
16257449 2006 Pharmacological profiles of cloned mammalian P2Y-receptor subtypes.
16109883 2005 The P2Y14 receptor of airway epithelial cells: coupling to intracellular Ca2+ and IL-8 secretion.
15829433 2005 Pharmacological effects mediated by UDP-glucose that are independent of P2Y14 receptor expression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15481977 2004 Architecture of P2Y nucleotide receptors: structural comparison based on sequence analysis, mutagenesis, and homology modeling.
14559350 2003 GPR105, a novel Gi/o-coupled UDP-glucose receptor expressed on brain glia and peripheral immune cells, is regulated by immunologic challenge: possible role in neuroimmune function.
12902497 2003 Human immature monocyte-derived dendritic cells express the G protein-coupled receptor GPR105 (KIAA0001, P2Y14) and increase intracellular calcium in response to its agonist, uridine diphosphoglucose.
12842911 2003 P2Y-like receptor, GPR105 (P2Y14), identifies and mediates chemotaxis of bone-marrow hematopoietic stem cells.
12695547 2003 Release of cellular UDP-glucose as a potential extracellular signaling molecule.
12559763 2003 Characterization of the UDP-glucose receptor (re-named here the P2Y14 receptor) adds diversity to the P2Y receptor family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12369950 2002 P2-pyrimidinergic receptors and their ligands.
11524702 2001 Mutations in a novel gene with transmembrane domains underlie Usher syndrome type 3.
11273702 2001 An expressed sequence tag (EST) data mining strategy succeeding in the discovery of new G-protein coupled receptors.
10753868 2000 A G protein-coupled receptor for UDP-glucose.
10704288 2000 A sequence-ready map of the Usher syndrome type III critical region on chromosome 3q.
9295203 1997 The isolation and characterization of a novel G protein-coupled receptor regulated by immunologic challenge.
8011297 1994 C5A anaphylatoxin and its seven transmembrane-segment receptor.
7584028 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1 (supplement).
7584026 1994 Prediction of the coding sequences of unidentified human genes. I. The coding sequences of 40 new genes (KIAA0001-KIAA0040) deduced by analysis of randomly sampled cDNA clones from human immature myeloid cell line KG-1.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.